1.20 score from hupso.pl for:
visualwebsiteoptimizer.com



HTML Content


Titleworld's easiest a/b and split testing software - visual website optimizer.

Length: 74, Words: 12
Description vwo is the easiest a/b, split and multivariate testing tool. try a free 30-day trial to start optimizing your website for increased conversion rate and sales.

Length: 158, Words: 27
Keywords pusty
Robots
Charset UTF-8
Og Meta - Title pusty
Og Meta - Description pusty
Og Meta - Site name pusty
Tytuł powinien zawierać pomiędzy 10 a 70 znaków (ze spacjami), a mniej niż 12 słów w długości.
Meta opis powinien zawierać pomiędzy 50 a 160 znaków (łącznie ze spacjami), a mniej niż 24 słów w długości.
Kodowanie znaków powinny być określone , UTF-8 jest chyba najlepszy zestaw znaków, aby przejść z powodu UTF-8 jest bardziej międzynarodowy kodowaniem.
Otwarte obiekty wykresu powinny być obecne w stronie internetowej (więcej informacji na temat protokołu OpenGraph: http://ogp.me/)

SEO Content

Words/Characters 1144
Text/HTML 12.00 %
Headings H1 1
H2 4
H3 10
H4 4
H5 0
H6 0
H1
a/b testing and conversion optimization platform
H2
how it works
the proof is in the numbers
as seen on
from the blog
H3
case studies
ebooks
webinars
case studies
ebooks
webinars
talk to a sales representative
write to us
tools included
what is visual website optimizer?
H4 testing & experimentation
research & user feedback
analytics & reporting
targeting & personalization
H5
H6
strong
$
$
a/b testing software
b
$
$
a/b testing software
i
$
$
a/b testing software
em
Bolds strong 3
b 3
i 3
em 0
Zawartość strony internetowej powinno zawierać więcej niż 250 słów, z stopa tekst / kod jest wyższy niż 20%.
Pozycji używać znaczników (h1, h2, h3, ...), aby określić temat sekcji lub ustępów na stronie, ale zwykle, użyj mniej niż 6 dla każdego tagu pozycje zachować swoją stronę zwięzły.
Styl używać silnych i kursywy znaczniki podkreślić swoje słowa kluczowe swojej stronie, ale nie nadużywać (mniej niż 16 silnych tagi i 16 znaczników kursywy)

Statystyki strony

twitter:title pusty
twitter:description pusty
google+ itemprop=name pusty
Pliki zewnętrzne 8
Pliki CSS 1
Pliki javascript 7
Plik należy zmniejszyć całkowite odwołanie plików (CSS + JavaScript) do 7-8 maksymalnie.

Linki wewnętrzne i zewnętrzne

Linki 135
Linki wewnętrzne 93
Linki zewnętrzne 42
Linki bez atrybutu Title 131
Linki z atrybutem NOFOLLOW 0
Linki - Użyj atrybutu tytuł dla każdego łącza. Nofollow link jest link, który nie pozwala wyszukiwarkom boty zrealizują są odnośniki no follow. Należy zwracać uwagę na ich użytkowania

Linki wewnętrzne

vwo
call sales tel:+1-844-822-8378
free trial /free-trial/
login /login/
menu #
features /features/
pricing /pricing/
blog /blog/
resources /resources/
request demo /request-demo/
free trial /free-trial/
login /login/
features /features/
pricing /pricing/
blog /blog/
visual website optimizer
resources /resources/
case studies /resources/casestudy/
view all /resources/casestudy/
ebooks /resources/ebook/
view all /resources/ebook/
webinars /resources/webinar/
view all /resources/webinar/
a/b testing duration calculator /ab-split-test-duration/
a/b testing significance calculator /ab-split-test-significance-calculator/
ideafox /ideafox/
request demo /request-demo/
plans start at $49/month /pricing/
sign up for a free account /free-trial/
case studies /resources/casestudy/
view all /resources/casestudy/
ebooks /resources/ebook/
view all /resources/ebook/
webinars /resources/webinar/
view all /resources/webinar/
a/b testing duration calculator /ab-split-test-duration/
a/b testing significance calculator /ab-split-test-significance-calculator/
ideafox /ideafox/
+1 844-822-8378 tel:+1-844-822-8378
sales@wingify.com mailto:sales@wingify.com
vwo
features /features/
pricing /pricing/
blog /blog/
resources /resources/
request demo /request-demo/
free trial /free-trial/
view all features features/
a/b testing ab-testing/
point-and-click editor features#visual-editor
thousands of enterprises pricing/
case studies resources/casestudy/
signup for a free 30 day trial free-trial/
62%
increase in inquiries
multivariate testing
hyundai

korean car maker increased test drive requests for test drives

details »
/blog/multivariate-testing-case-study/
158%
increase in trial signups
a/b testing
get response

the leader in email marketing a/b tested call to action buttons

details »
/blog/a-b-testing-free-trial-button/
41%
increase in sales
a/b testing
smiley cookie

the us based ecommerce store tested the next shipping v/s other offers

details »
/blog/ecommerce-increase-sales-2/
25%
increase in registrations
heatmap
pair

the popular app for couples ran heatmaps on their landing page

details »
/blog/increase-conversions-using-heatmaps/
features /features/
services /services/
pricing /pricing/
faqs /faqs/
knowledgebase /knowledge/
on-page surveys /on-page-surveys/
visitor behavior analysis /visitor-behavior-analysis/
smartstats /bayesian-ab-testing/
integrations /integrations/
compare vwo /compare-visualwebsiteoptimizer/
free trial /free-trial/
free trial /free-trial/
blog /blog/
case studies /resources/casestudy/
guides & ebooks /resources/ebook/
videos & webinars /resources/webinar/
a/b testing guide /ab-testing/
split testing with vwo /pages/vwo-split-testing-tool/
free tools /resources/free-tool/
vwo for marketers /pages/
what is multivariate testing /pages/multivariate-testing/
conversion rate optimization /pages/conversion-rate-optimization/
about us /about-us/
careers /careers/
partners /partners/
contact us /contact-us/
terms of use /terms-conditions/
privacy policy /privacy-policy/
opt out /opt-out/
日本語 /jp/
sign up /free-trial/
#
#
terms /terms-conditions/
privacy policy /privacy-policy/
support@vwo.com mailto:support@vwo.com

Linki zewnętrzne

here https://vwo.com/?pagespeed=noscript
making cta more relevant increased conversions by... https://vwo.com/blog/increase-relevance-to-boost-conversions/
removing a line from header image effected 7.8%... https://vwo.com/blog/dutch-major-achieved-7-8-increase-conversion-removing-line/
killer headline beats image slider: an estimated win... https://vwo.com/blog/image-slider-ab-test/
on-page surveys report 2016 http://resources.vwo.com/on-page-surveys-report-2016
how an ecommerce major achieved 26% more visits-to-order... http://resources.vwo.com/shopclues-vwo-cro-case-study
on-page surveys | download guide http://resources.vwo.com/on-page-surveys-guide-download
[webinar]: planning your conversion optimisation for... http://resources.vwo.com/cro-planning-and-execution-2017
[webinar] do's and don'ts of moderated user testing http://resources.vwo.com/webinar-with-karl-gilis-moderated-testing
vwo and talia wolf webinar | convert mobile visitors... http://resources.vwo.com/webinar-with-talia-wolf-convert-mobile-visitors-into-customers
landing page analyzer http://landingpageanalyzer.io
login https://app.vwo.com
play https://www.youtube.com/watch?v=pmxrjt6fud4
making cta more relevant increased conversions by... https://vwo.com/blog/increase-relevance-to-boost-conversions/
removing a line from header image effected 7.8%... https://vwo.com/blog/dutch-major-achieved-7-8-increase-conversion-removing-line/
killer headline beats image slider: an estimated win... https://vwo.com/blog/image-slider-ab-test/
on-page surveys report 2016 http://resources.vwo.com/on-page-surveys-report-2016
how an ecommerce major achieved 26% more visits-to-order... http://resources.vwo.com/shopclues-vwo-cro-case-study
on-page surveys | download guide http://resources.vwo.com/on-page-surveys-guide-download
[webinar]: planning your conversion optimisation for... http://resources.vwo.com/cro-planning-and-execution-2017
[webinar] do's and don'ts of moderated user testing http://resources.vwo.com/webinar-with-karl-gilis-moderated-testing
vwo and talia wolf webinar | convert mobile visitors... http://resources.vwo.com/webinar-with-talia-wolf-convert-mobile-visitors-into-customers
landing page analyzer http://landingpageanalyzer.io
login https://app.vwo.com
- http://www.smashingmagazine.com/2010/06/24/the-ultimate-guide-to-a-b-testing/
- http://thenextweb.com/dd/2013/12/09/5-ways-improve-websites-conversion-rate/
- http://mashable.com/2010/11/04/a-b-testing-resources/
- http://forbesindia.com/article/30-under-30/paras-chopra-making-websites-fly/37201/1
- http://techcrunch.com/2014/06/25/wingify-launches-a-new-ab-testing-platform-for-people-without-coding-experience/
-
posted in a/b split testing on july 11, 2017
https://vwo.com/blog/sort-and-measure-method-doing-user-research-from-product-reviews-for-ecommerce-ab-tests/
-
posted in case studies on june 21, 2017
https://vwo.com/blog/structured-conversion-optimization-process-kula-partners/
-
posted in conversion optimization on june 13, 2017
https://vwo.com/blog/increasing-website-conversions-with-the-right-messaging/
team blog http://team.wingify.com/
engineering blog http://engineering.wingify.com/
http://wingify.com
https://www.facebook.com/visualwebsiteoptimizer/
https://twitter.com/vwo
https://plus.google.com/+visualwebsiteoptimizer
https://www.linkedin.com/company/vwo---a-b-testing-&-conversion-optimization-platform?trk=company_name
wingify http://wingify.com/
english https://vwo.com/
forgot password? https://app.vwo.com/#/forgot-password

Zdjęcia

Zdjęcia 32
Zdjęcia bez atrybutu ALT 24
Zdjęcia bez atrybutu TITLE 32
Korzystanie Obraz ALT i TITLE atrybutu dla każdego obrazu.

Zdjęcia bez atrybutu TITLE

https://vwo.com/blog/wp-content/uploads/2014/04/xpricecharting-logo.gif.pagespeed.ic.nik3hfafou.png
https://vwo.com/blog/wp-content/uploads/2015/03/xvvaa-false-button.jpg.pagespeed.ic.fmux2bnjuw.jpg
https://vwo.com/blog/wp-content/uploads/2014/08/xmeddelandelan_logo.png.pagespeed.ic.w9ac6fxwmu.png
https://cdn2.hubspot.net/hubfs/310840/cover_ops%20survey%202016.png
//cdn2.hubspot.net/hubfs/310840/case_study_vwo_and_shopclues/shopclues_logo_2.png
//cdn2.hubspot.net/hubfs/310840/hyundai_case_study_ebook/image.jpg
//cdn2.hubspot.net/hub/310840/file-2620503112-png/landing_page_critiques_resources_image.png
//cdn2.hubspot.net/hubfs/310840/vwo-inflow_ebook.png
//cdn2.hubspot.net/hubfs/310840/vwo-inflow_ebook.png
https://vwo.com/blog/wp-content/uploads/2014/04/xpricecharting-logo.gif.pagespeed.ic.nik3hfafou.png
https://vwo.com/blog/wp-content/uploads/2015/03/xvvaa-false-button.jpg.pagespeed.ic.fmux2bnjuw.jpg
https://vwo.com/blog/wp-content/uploads/2014/08/xmeddelandelan_logo.png.pagespeed.ic.w9ac6fxwmu.png
https://cdn2.hubspot.net/hubfs/310840/cover_ops%20survey%202016.png
//cdn2.hubspot.net/hubfs/310840/case_study_vwo_and_shopclues/shopclues_logo_2.png
//cdn2.hubspot.net/hubfs/310840/hyundai_case_study_ebook/image.jpg
//cdn2.hubspot.net/hub/310840/file-2620503112-png/landing_page_critiques_resources_image.png
//cdn2.hubspot.net/hubfs/310840/vwo-inflow_ebook.png
//cdn2.hubspot.net/hubfs/310840/vwo-inflow_ebook.png
/images/page_home/how_it_works/mobile.png.pagespeed.ce.qrcgpav5pm.png
/images/testimonials/scott_swanson.jpg.pagespeed.ce.tfog9refsk.jpg
/images/testimonials/xroger_elliot.jpg.pagespeed.ic.qckqxrfgjw.jpg
/images/testimonials/xsunit_singh.jpg.pagespeed.ic.rg9jd9mflx.jpg
/images/logos_media/sm,402x.png.pagespeed.ce.yahbm4lwcn.png
/images/logos_media/the_next_web,402x.png.pagespeed.ce.oe-mifkp5o.png
data:image/png;base64,ivborw0kggoaaaansuheugaaauyaaabqcamaaabs8szwaaaapfbmveuaaaaaar4ae8yaemuadmmafmgaesuafskafcgafckafskafcoafskafskafcgafcgatryafcgafmgaf8qgvtd3aaaae3rstlmad0krhhe3zyr+47db75tzbmv9wplnnqaaca5jrefuenrtnnmo3samhoctoldd+79rl6p2gbestkuqvfnvqngaflenge4/tra2tra2tra2trb+t6ljupkttypjklqy1qo1/vhhffug3/mwrx9kr6znao0+/lh94xhlbqk9p0ntjjnsb0pk5upqg+ok8xaghqzkxgigd3tcgi02xledqvexjaq3xkefa7juf0hqyxyk+x1hs9jo2bhbuelvo6zlxgi6gvlqqbjgewmcjduhaowc5bib46dcrwnwudzmywtxiuru2lsnewxpkm7zxpoon8zbbuiiwrqkyqknvx+j+nmy0wagjd6cpkfx9rsjhbdupseh2msmkgblzdkkygop8ftolorxortwxh5pm4wuk4zlan7gal3rhchpnlfnv1nvqr6bsuj3atmdzzdqmr4h47fhdi/ituxzzoghdluf7uvkhgoxxlikhbgzmtwawshmhmwkbiqncho6u2umakrzsd/fkmz8frfpdpvxmrnkkum6jkch3wkndkjxl42yc4xcmkhvppddd1jj8bifg9zncbgvh+0ek5kmhkzdzc88yow/kifoypx51rnchdcwtckonpztz1u5jiropqprjjiz9uj5u/8rqaixlubrjhevwp7nkbdmbebq20qn0jujr2nuphfuvxhz53sqdbi8jk7hxzf9oddqvljcyqery4y0s9kcvggjq2gmnlvayzsdl6l2exjcixu8pm8zrgel43yirxelgjgxay1xuhgjr7osmla+ubteeotomb7pqcemuymfpcn9fycwjwleaoykuqay13iljedfkhfmx+sbbxegjw7qxk/u6pxcjuyurnjjjxi7yjgkoduu95zmj3juzskdpjgpoiuhvczud62fku6kpcj1us0fstaxpxya0ykmfboqd61vdvpj4rfgz2l0k5n+ttabr+e0pkcabbahcfkghkbn0yh2ss4og8afsana2qwh0ttn6ah+mdtx21istsmyq1zavy/ckcf4kfleyk+uc9cs5zc5yk+q/f2dhguj9meewzg/mine8yirmjq7swpua4edxhjljz5bwdggo6chbzchmbihto7htmmymfbhjsd6o4mvtecueuboz6wqnwlxnwlmeniyfvojkxfofe2zgjoc/apcjgzznxpuyhi0a4ysou4ln6/rbaljwr/skrkj486thww1aywotgtnhuu4glh0ibnpfi55fnwkrjeg7pocznxexi07cqjwjuzq6hzjphg/odsagp3awm4vw5qshcqomz+59yqa8vxfemnmd91qec7rnwkmcng+lcimmvuzaam9gcgvczbkemke+7ole37rsv9coxyyffvczfxldz2tqbjf4rttuhjridhll/jx1rrbgswcvwurrwdelneyi4mdl2s2pqcrt6rfecnac7hrjodqnrepjknfegh/c1uvl6jjibl0zrx+wmpgdsof0zvgizecx7md0s4p6cmm4t5glnap0d0etiqo2apytoqqwgoumqycowj9icawvhvtciznpzb6uoq7h1c/meyltg+szjk2l5/akgz/vyz6emo/jzcjjlqzegefsdjeccnygjccbxmmsdj+mzf+fb4jacuhncpt9dfqveri1qbvcvdzdet0gcp+inh6fb7lrvubmsrw5ezwvyfsez2aoxxvby6xvidxoghihxgv/a5swc96jfea0zjggg9rjkcttqhmf8qf3lzr6z3m7p4pcmr4idhhs8dngdmywwengit2ns+5xymkhgwdmkmxjhivjzb9cgnhdgllo3vjwu9i4jat1mq+qrxmjrumpknlj54yn1ixuxcbiye9vatzw11i9kbtyvxpzevgl4vfvhgkywp/5lujvmvxbhkad5w4rsfxo/kd9pqio2hknnwnus5w3wefuqix4dwobgj/ivmbjw9lxlkpjpxrhccycrwor87xydfct8uy9e3rni6iyph7cbp8wsy4blrwynlpy/qmxs5ixaxsbvweyusojwxgrnkpfnm0rgm6noptyoxwgohz3ki/xcuyktswnpjpjbukbvaele5f8tsxolkpzjfen3j0qts8fbngttznmqaujxim3b/a1qks/qqnucxm8prhzkexs2jkozgycsadss+rnxyxe7wgmbl4mysjtf78fno9ejxqyaqxoyxnhmr9hjtgtejprmq3hbml8z0twzj0m/+jlda7nnvdq/hqti4stu+mcr708aijgj7wtiodseomvklgmiqbfy5omlklfoadk5fvwctg9xh7a4zafok5rslfpql9rycpckubxlwi3c2rmqsldmddjkzfs4go4pvwn8psx2ujsyeb0rgtyk6cghgjjoyhgew/1gewnqxdlrxgei6chs4ykal+nowwkq2uyoh9kf8ezzdeczm5m51cofixviza/pubiwzwfdaghe6ev1dmd4b7esh3eua+auwcsmh5tgks632jkqkk/nafzuz+lpyehmduyoxbryl+iuaoo5litxmc8pt3nnd+iadcxrzd/s4lhx/yyo+bwopvrd3wkam2j38y+bwjpo30ctfy6/xpktp6hsv462cp4xwn7bbvuy87cuh9rck78fll+lb74buuanxvjldc0lsy+rsdyvusrkb3b3z4qw/ekn+p1xfrepwndxadyd9igw8ruiw+frekbc55z2rzmulcm0vjtzovthwuivtkydxjqvoquprsy+p5d1pw05z7nnj5z/4fzltbw1tbw1tbw1tbw18awlz2grdg/10aaaaasuvork5cyii=
data:image/png;base64,ivborw0kggoaaaansuheugaaapqaaabqcamaaaazfkg0aaaanlbmveuaaaatxpkux5ssxzguyjssxpkuyjsswpcux5ovrjauyjsux5omvzyux5stxjguyjswyzwuyjuolbhbaaaaehrstlmacsjs42lymjam0omdoegzdiuprgaabnfjrefuenrtm+t62yamhs0zzmm6/5vd2savqwcil3v59vj7syxgofciweb0uxxr1q1bt27dunvrwvxsdl2xh5feonb2uon7vrxkqfgsp4fsy49re0ryrbwcu/wx0hjm+lodm5a+f17ospunowf7a+gpsdqqucvz8slyx0pwkixzb2rlo4qeajxodiyvkic3ghzl0phqanwt9mleanopozgtk+gl0a7eapqvs5pc97imxyh+ftciglynm18khd8c2oygg/684paxyl8ftbtbl+qv0owtobcyqs/6hddqpad1edp3zyf8v9byco3+p+ivqbpzi7rlyltrprmdpxgl9luejzeqgw+l56gn+bjwk+nonumcfvpggl2bdrct4et/xr5fx9tjtsvspy77rmyzgxbjcqkbylxihezxwnuyanqomhxn48zmlmssa+g+/sl0p8qq+x68wooitbo1tlfqdeww0wmfzclietyika5co9x3x5jnjfknzm/cerhabyixlgldqw0oplohnotyu6gtmgue+uhjtdwphxjwc8rsq4laovy4jhrxts2zwsf0w+cjp/n+srvw2bx8oox7chr5hzovj20b1xqiqlgotf9e6qmcrxf7osv/kdynpksg48byt62pbcgfh+zh6askia9vc8jcce2kj6ag/sxdjkj3gqvdocm1ci563xtxpg2tipsn0aabyfxjep8paslzppvqc3qotmnltka9bwo/8lrgx6eh8taedpo4uixnqkmoinniosm1dmgcjfpedjx8o0jkfehwlmvt5v96ipxbm7yy2aobluio7qloqa5qrxpj0tvyswi3ivqxakf3wgbqqlyycqpohnnfkiflrzdrkv91ymqiaxpapix4vbswnog9a4jc2r8avyyewzjsxvnoen7dso+xeqqhqztzxexroeg1z76uunwwmv6dgo63orp/0ea7pv+xm+iw0e95j9wgejqb1jzod6gpenpwoycs9arv13cugixj6k9k7zcyycx0bqy808x/ak2r4vf5q0xanzqhpqnmklvosqbcqw9qunktc9dwwzw0izpqflvwhbouwmi199dji7lxtqiixfle5oirerbakzxbzj+gdcemoemidhwccy6eyayr8jx+hmgph1kjdmg6nshf783xobc4wlqziufxkwchb0nlnofgeln1a31yao6fhea9ozraidqx6b1y9u4s9jj3ae2g2yvreuj0bpralai4c63al5i7am12dvl6qzd+xghd9qmtkf9uqaaimeahuximbsh0nideirkemjakcrjndewctp8b0gkkgiogjkov1q0t9jx0gi/obrlaxosm4q3ecvt09i4k0owdqefqmdz/dvpwo8tccsmz3l7xl8+9zd/nid6bl0lrkspzmkupsw1rtsumto2gwhhazdynu28e6urxk65hcopmtnhpk0fqtl+gcjidv6fnnvketx0ssu7gtx71rvobdkuw3gc6yjfng4tjx5wfuzq1xiaz99n59fuf1n1w5myuax7aku/lvhwrghasmddzmyo+igxwhud8etqngdfvm+ujo8nxjqhdnuzcduof09w+nhchoh20achxsplkwwxhxmkcqqfxryfnd3xpwhse2k9c03vca+rqce9gqgustgdwuk9renooeginh4ftgjk42axtni7vdag160zmnppjbbpfa2st+fyciinhqxon2wlgujlmddj7s11omxuu6eenji2jwtla0+iyoh76d6urulokmpyjtbangltss+iqh6fjoityonnhna3vq2j6biwrpyfk4ghxenfj9ibahl0x3gb5uwo1abqfzg+izmojp9car5cwj2jdxw098zhrfzmlraz2ek2dsgn4o5vcakycwciizuxdo1rnljlsu3f3sdewn4qz9xyfekqg2hdy4u7da6ymilb1eyiy9vwzegib43qmvnromccqx+qohgd5fddt9dav5ptbyhsuurjqw5qae1qqppwgo2isa35sotvj07mg02wqzlbzuzw85firism8rsbjrpbnp062qbthnzogax8csw0o8hdopjm+1yfh6ukjj89uhn3tfapisvkojdcyzunkszjm+ijze9qh9mf5oykkun/w6dwqclwtxgxe5adx9monojjfwwli7fprsuufl5hh03qnzcy3bt26devwrvu33k2/adyba9ncnwewaaaaaelftksuqmcc
data:image/png;base64,ivborw0kggoaaaansuheugaaahgaaabqcamaaadlrug7aaaanlbmveuaaaaalgaatwaa3gaaaaaaywaalqaavwaavqaazaaa3waaaaaagaaawaaamaaazaaa5aaalabm3wflaaaadxrstlma9t7oaftq6/fo+gicbvmxxqaaagrjrefuan7t2nf2mzamggegssvvk5je/2vn09qapnzqa4gt1v9voq35iheeyddr9xrv19+va/lpx9qqiwnziceh18hs4tngyebxibhwsapgusvzzsk+blirgrki81mw+rgwybghjwfx7td5udfvxbzudp61nuexdtdqzvw94v/ka92g7fayd8uqgagmbazeihvkws6uwhzkthegswcilzstxkezko3zog63igfixuex8fgi4ztklmwyowmd7lgcjzmrkrx6nzyuqyyyt8omdb6tysjayxt8z8cudgf6q5nuy3ohhhitexaxy4n+l4/ld1/k/yspa0xyn+xpi8wvgyc6whbb4emdgojpydwotlc6h4owa1fc/b3ogc6ab+sbtn6pic6ewtjnvv0whbgfno+bsrk2x8bwwrkrlmjlkovh8kv33a8j/r8um8ubu8cf2mwfnxkrcnanphf4fjgv9nc9o2fhyx4o67xkigfjofyxkptzesa8hg6bg2e8goywwkqcvs6ffdzrekqb1xvhpnor05v4hfwkcx3gq4plx8ibyypvwhgvdffbuwns7ewze+bjwkuavs98fldrpzdwnphlmfxc9n4wvhp2jg9p/jhuwewbeymgfpz4n2cc74gn1qjsfxdt1atih3g6azahwlyddvrrvgw3wrijdgpdee71er236x/kx/a44x32baaaaabjru5erkjggg==
/xresample.php,qq=https,3a,_,_vwo.com,_blog,_wp-content,_uploads,_2017,_07,_amerisleep__shop_eco-friendly__memory_foam_mattresses.png.pagespeed.ic.o0ya367kkh.jpg
/resample.php,qq=https,3a,_,_vwo.com,_blog,_wp-content,_uploads,_2017,_06,_tirecraft-exit-surveys.png.pagespeed.ce.nuxeidbnjg.png
/xresample.php,qq=https,3a,_,_vwo.com,_blog,_wp-content,_uploads,_2017,_06,_privy____vwo_docx_-_google_docs.png.pagespeed.ic.zwffkdtjo6.jpg
data:image/png;base64,ivborw0kggoaaaansuheugaaakqaaabicamaaabp7a6kaaaaqlbmveuaaaaeiscdicyufh0eiccaaaidisyeiscrfx0eiscbhsizhcedicydiccchyudiccchyqeisceicyfiscgiykeisdmmbf/aaaafhrstlma8lyzqav0xa/ylingheioposytwrwzqqaaautsurbvgje7zrrdqmgeic5i3hbnl7/q26ajaoijdn2dm2ezi8mbowpyw5qirdj3xq7okzoghjfzpckfhdomja2t0tl4ynn28vljst4taamkwskz/qotxpipammfxxtks1x97+mxfbyhc8rv9qxxoso3k838azjliye7wp5gbys/aeq3eygs3imsps6fd41cg3twlqooqn6tj7kzndwox85pqhzdc2jmmohuyjojmlruvt6dbkl3wn6dkwhmqzxs0zxvcjje6i0006hkmu2+gwsxwyrmj76hes+zcr8jaxeymuq0gidydqky5h210zhy8i1bvsopkxacmuwoyqegbapmk3qo/jsjixl68qoiun3kyfixtue3c/xsc3dpsrotzlzgtwpgw3kwfl2h5cwmuecjuj5ruvhct2ounyone8ecgjxrohhuiopi7kkpmvoiyl0n1dbtrgzx1oacnxecuk21ekqqy+u/uggherjc4hk++ezmldfqbigd+aqe2kyk1lhx9h9v4eem8z5g9cwtq8odktbi9qxkdrcaw4y++cdftgaalsjcrw1ym5xw4fzjmigiowxltmhtjyhjklfyiejbybfmm0l2cwcqylrmt64oqp46eykx0mcqrbgdkdjj9nkvgio21ftosdfxhhgn5xdajwsgtgeq7oahjb0u4jze0nbyd0ixa9cb4/ntz6iitsfqsov/ahbzi6vuv1znksk4/bj2r6hs+xwjfg4djij17uercxrzeq09yjvrsrhrb5eqthi0cgoocztqwgztvnab7mwh4hswfbqjgh2uck3z5ajzay+p9j8hxltjeprdcqvpkc5hispictazxvfgrn+e7jrujg535srvo9nqck1ldrotgnt4blonxwluvjjqxzuneqsveorkfl5pem6zd5dlrhpdycbpmixmjx6metcwj/oifeh0xbn8jhgn4bcb57knik5ojnmx5b03qimnbwmvkfxi5p0g8asi8tvbmox1s7i1kuw7n+qux/gmc3g4ivilp5jyj+xoitk/pry/yok78yoxeapxnocxz3bkd24d38ybp0dsnxq2c2yl5vg/vuqmlejwc7timbbfwgjqusbyp4smjb9ikl1xrztoarqmpu/l9x05rzjgyegpw0vsnif55aonnwfukp0lty5/yarck0xre+ylf7b9w8riz2daxa/hmr6+cvi2tdlineyq11l+1auonq7rcsdbbadtpevegfrkdlof5hqdc5byopkfcjgecqhlprgj1blfrjdonj6ctzmcsw5rshndci20otoasnu+jxifmbflkmvswaxgjqgby7/netczqxhcagpvbxnnv0fm4qrz7kxurqbjhycnliw6vgkek8+abikdek7xz6brfucxrgweqzuaaiclllon1q4x1ygyqeaeqherk54htilzhi0twac1meca1lhhbuhiiqqjz9pg5aw2uololqdes+fdswmxxqpitqgrtiryxkkx77al4k5ov8ximxjwpvuktoofpze7l2ab6t2uk2lxlvom0d62fyh7mc/anjbsf5iqw891no3hnacqfbdcrjzoztx4+ts8xjcgrjb09e65i6ixzbcrmlscfff/6jk4ulavpyjoclshgbwgt4y6euif9ykosw1sjbugtmixuyhupvyaprz8+cfonetd+qh8mri+d7j5aw3ea3slv6oe4txe9/ijc/3ef32lv48fonxup8aami89h0tyl8aaaaasuvork5cyii=
data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wbdaaudbaqeawuebaqfbqugbwwibwchbw8lcwkmeq8seheperetfhwxexqafrergceygh0dhx8fexcijciejbwehx7/2wbdaqufbqcgbw4ica4efbeuhh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh7/waarcabjaekdasiaahebaxeb/8qahaaaagidaqeaaaaaaaaaaaaabgcebqidcaea/8qaqraaaqmdagigbaoibwaaaaaaaqidbaafeqyhejehe0fryyeuingrfti2cnosoblr4qgwizq1ulsxf0j0oshw8f/eabkbaambaqeaaaaaaaaaaaaaaaidbaubap/eaceraaidaaicagmaaaaaaaaaaaabagmreieemrnbfciy/9oadambaairaxeapwbklnyfib7tw8pb7kwkallmim5yowwvsohhg2duse7fck2apslejgstnmljo/tqzltyl1qzm1xvwbwgx2jp+y+vrb3axrehtakkkickkct8y91hfpnji5ktta9fc44orysvhxnyiffac4kluhq5yjryy7grx8jxnh2r7qfkerb8mdc+ym9csyrwg6gcr0evmlk9gdwjfzneils0cfx55whsk8a+6li4hxrcikp3wd4g0wngxkzwbefuc8geqe1q/euuuc7qcja8zanwmck5edkj3q3p21v+d4v9m39uvlarlhgpfs9y/iicrkhete3jtgckdhqssmdflukitbww0r5prx4jogjtlzxjustskdyetkjjgruftq811o5uyqqr1susgkjsbufgpfrhcynu0i5lul6gegqsj4jgq4qbskju6q0/dnqxennlc7qvdcew0qtbzo0wh8atoc71desy5fdjphacya5c6+hw5kg04pikurzsorpzxfr9klppznvuldwcklwab3acsuk3gwa3r1nnonpwczjffybxqh48yvwltvltsml1zqwedcy7o+qbsvh8prqjipwghffgv9w2/cfu2tkk9wrbbzmhpsuipgvsjehxchcsoygcngovork3fpkhkrube0nadfpovfivshu1uty65r8efjxn61qp5h/qj8awdryfj3qx001icuqurwevys251lagcfq4tgyo3fuijhfvhpzx1jultdbtxkelsaz55igptrrdra5lq1sfhvb0wllecyfgqmdchsegqova7yydt44orlwuunskeudctwqis620wyntycdy510lc0+wqi4yhao6gtngakcr2ljbg/bjbobnhc7mus57wc7bdqsve3y0kl12aso319cb1biunq0qw6hclmsup2chsatgkjhppzzipdkssydanxv+2ad4alwkk+ox2fpj9ivhhuyq4laqlpisab2af+udaatztwtzjqeb6oeggoyt5giuwkl9crqzseal30btcdbiekbwchxoakzo23vqrohr8s4ltsiqpkuioiwgeeju3zzow1jbtb3zhquhjhrygaruvo+bamd3jbcunxsgfp2uuzays6ri1p630zajiydhq7qftkfjxv8ahnn/kt3/ahyphw8ck0tpcjsvc+qqb1o7v93505jembg50c6wkrlqyl0teuogfljrxkfnuiayb4j3vhh6enoqx2votthzwdkmqeakazkyapmbb00npji30ygk+ucea7eusuntpozlpbclbbioewrt3flvbxn/tfnd4osscskcurgzstrucnjg9b8goh6qq6lds6sqy2ghi8ykbgrbkljpt2uejrukutqha2dipiaglv8abzcaei7cvrs2fvw2kdoowe/as+2otn7wlxogb2kxpvueu4puw3bc6milpwqaiiaocutde3h21s3oikq26rjqo8qyfsflmavjznsm+i4j6tik/aqmmlncjbe9d8lsnva5axy91cxynuxgsaelzfpjflopkgcan7kiujscvqg1utk5gdwrjjz2mhlqk7owpcscp1wcscad++dgevppsmlxatuzstjibtngo4d21opr3tmz5n2vclcggua+jqzwke52axnfs/g5h9o99x86v2ikw8ysrit/uebqnchq5kudetppxxuraib5eut6rkgtzkpx8zolb8mghefxjpt/4ok0l+6y/pj/ahpsl+rflnlqdz7iwsqobxji2ibt+dits1/zm2ikl+u/f4mhxziukkzptxnzp/yv3w4/np3k5s6pp4zqt/vofenr2rcndww1pd1ndlk405isw0p/jsghc58bsgv8l9lzupitlkhdlepidvi7abtc1b8pnpol3evlsr6eueyopnnsooia2pkutujeordxxokiciryhf1sdnjhi11cucltaaaobjvzjaucnhfkgj9efvjrqgr8zz56v71td0zlv9mhniousaofhwpoq7j7qslc68o2l9h/2q==

Zdjęcia bez atrybutu ALT

https://vwo.com/blog/wp-content/uploads/2014/04/xpricecharting-logo.gif.pagespeed.ic.nik3hfafou.png
https://vwo.com/blog/wp-content/uploads/2015/03/xvvaa-false-button.jpg.pagespeed.ic.fmux2bnjuw.jpg
https://vwo.com/blog/wp-content/uploads/2014/08/xmeddelandelan_logo.png.pagespeed.ic.w9ac6fxwmu.png
https://cdn2.hubspot.net/hubfs/310840/cover_ops%20survey%202016.png
//cdn2.hubspot.net/hubfs/310840/case_study_vwo_and_shopclues/shopclues_logo_2.png
//cdn2.hubspot.net/hubfs/310840/hyundai_case_study_ebook/image.jpg
//cdn2.hubspot.net/hub/310840/file-2620503112-png/landing_page_critiques_resources_image.png
//cdn2.hubspot.net/hubfs/310840/vwo-inflow_ebook.png
//cdn2.hubspot.net/hubfs/310840/vwo-inflow_ebook.png
https://vwo.com/blog/wp-content/uploads/2014/04/xpricecharting-logo.gif.pagespeed.ic.nik3hfafou.png
https://vwo.com/blog/wp-content/uploads/2015/03/xvvaa-false-button.jpg.pagespeed.ic.fmux2bnjuw.jpg
https://vwo.com/blog/wp-content/uploads/2014/08/xmeddelandelan_logo.png.pagespeed.ic.w9ac6fxwmu.png
https://cdn2.hubspot.net/hubfs/310840/cover_ops%20survey%202016.png
//cdn2.hubspot.net/hubfs/310840/case_study_vwo_and_shopclues/shopclues_logo_2.png
//cdn2.hubspot.net/hubfs/310840/hyundai_case_study_ebook/image.jpg
//cdn2.hubspot.net/hub/310840/file-2620503112-png/landing_page_critiques_resources_image.png
//cdn2.hubspot.net/hubfs/310840/vwo-inflow_ebook.png
//cdn2.hubspot.net/hubfs/310840/vwo-inflow_ebook.png
/images/testimonials/scott_swanson.jpg.pagespeed.ce.tfog9refsk.jpg
/images/testimonials/xroger_elliot.jpg.pagespeed.ic.qckqxrfgjw.jpg
/images/testimonials/xsunit_singh.jpg.pagespeed.ic.rg9jd9mflx.jpg
/xresample.php,qq=https,3a,_,_vwo.com,_blog,_wp-content,_uploads,_2017,_07,_amerisleep__shop_eco-friendly__memory_foam_mattresses.png.pagespeed.ic.o0ya367kkh.jpg
/resample.php,qq=https,3a,_,_vwo.com,_blog,_wp-content,_uploads,_2017,_06,_tirecraft-exit-surveys.png.pagespeed.ce.nuxeidbnjg.png
/xresample.php,qq=https,3a,_,_vwo.com,_blog,_wp-content,_uploads,_2017,_06,_privy____vwo_docx_-_google_docs.png.pagespeed.ic.zwffkdtjo6.jpg

Ranking:


Alexa Traffic
Daily Global Rank Trend
Daily Reach (Percent)









Majestic SEO











Text on page:

please click here if you are not redirected within a few seconds. vwo call sales free trial login menu features pricing blog resources request demo free trial login features pricing blog visual website optimizer resources case studies making cta more relevant increased conversions by... november 22nd, 2013 removing a line from header image effected 7.8%... march 26th, 2015 killer headline beats image slider: an estimated win... august 21st, 2014 view all ebooks on-page surveys report 2016 february 28th, 2017 how an ecommerce major achieved 26% more visits-to-order... april 27th, 2016 on-page surveys | download guide april 21st, 2016 view all webinars [webinar]: planning your conversion optimisation for... february 28th, 2017 [webinar] do's and don'ts of moderated user testing february 27th, 2017 vwo and talia wolf webinar | convert mobile visitors... april 28th, 2016 view all a/b testing duration calculator a/b testing significance calculator ideafox landing page analyzer request demo login a/b testing and conversion optimization platform use vwo to tweak, optimize & personalize your website with minimal it help. plans start at $49/month sign up for a free account no credit card required watch how easy it is to a/b test your website play case studies making cta more relevant increased conversions by... november 22nd, 2013 removing a line from header image effected 7.8%... march 26th, 2015 killer headline beats image slider: an estimated win... august 21st, 2014 view all ebooks on-page surveys report 2016 february 28th, 2017 how an ecommerce major achieved 26% more visits-to-order... april 27th, 2016 on-page surveys | download guide april 21st, 2016 view all webinars [webinar]: planning your conversion optimisation for... february 28th, 2017 [webinar] do's and don'ts of moderated user testing february 27th, 2017 vwo and talia wolf webinar | convert mobile visitors... april 28th, 2016 view all a/b testing duration calculator a/b testing significance calculator ideafox landing page analyzer talk to a sales representative +1 844-822-8378 or write to us name * work email * the email you entered is incorrect. phone number the phone number you entered is incorrect. nature of enquiry * select your enquiry sales enquiry technical support other message you can also email us at sales@wingify.com vwo features pricing blog resources request demo free trial login how it works modified page original page $0k sales 0% conversion rate $0k sales 0% conversion rate create and a/b test different versions of your website to continuously discover the best performing versions that increase your online sales. tools included testing & experimentation a/b testing split url testing multivariate testing research & user feedback idea factory real feedback by users landing page analyzer analytics & reporting heatmaps revenue analysis segmentable reports targeting & personalization deploy personalized content target specific visitor types measure visitor segment metrics view all features what is visual website optimizer? it's an easy to use a/b testing tool that allows marketing professionals to create different versions of their websites and landing pages using a point-and-click editor (no html knowledge needed!) and then see which version produces maximum conversion rate or sales. integrating our split testing software is dead-simple: copy-paste a code snippet in your website once and you are ready to go live! visual website optimizer is also a flexible multivariate testing software (full factorial methodology) and has number of additional tools like behavioral targeting, heatmaps, usability testing, etc. with 100+ features in visual website optimizer, you can be sure that all your conversion rate optimization activities are covered by our product. thousands of enterprises and small businesses are using our a/b testing software for landing page optimization, increasing website sales and improving conversion rates (see all case studies). signup for a free 30 day trial today. the proof is in the numbers 62% increase in inquiries multivariate testing hyundai korean car maker increased test drive requests for test drives details » 158% increase in trial signups a/b testing get response the leader in email marketing a/b tested call to action buttons details » 41% increase in sales a/b testing smiley cookie the us based ecommerce store tested the next shipping v/s other offers details » 25% increase in registrations heatmap pair the popular app for couples ran heatmaps on their landing page details » vwo's thoughtful user interface and large library of success stories enable constant site testing, even by non-technical people. scott swanson consultant to microsoft we're smitten with vwo for a couple reasons - it's pretty simple to set up, and reading the results is a breeze. checking test results is our new favorite addiction. roger elliot ceo at uncommon knowledge we redesigned our entire website and vwo helped us set a/b tests to gauge the performance of the new site. we used it extensively. sunit singh chief designer at cleartrip as seen on 50ms average response time 1.5bn+ visitors served 300,000 campaigns created 99.99% uptime of servers 4000 customers and counting from the blog sort and measure method: doing user research from product... posted in a/b split testing on july 11, 2017 how kula partners followed a structured conversion... posted in case studies on june 21, 2017 how to increase website conversions with the right messaging posted in conversion optimization on june 13, 2017 product features services pricing faqs knowledgebase on-page surveys visitor behavior analysis smartstats integrations compare vwo free trial free trial free trial resources blog case studies guides & ebooks videos & webinars a/b testing guide split testing with vwo free tools vwo for marketers what is multivariate testing conversion rate optimization company about us careers partners team blog engineering blog contact us copyright © wingify. vwo is made by wingify. terms of use privacy policy opt out english 日本語 visual website optimizer email address the email address you entered is incorrect. password the password you entered is incorrect. remember me forgot password? not a registered user? sign up sign up for a free trial no credit card required work email * the email address you entered is incorrect. password * the password you entered is incorrect. full name * phone number * the phone number you entered is incorrect. are you an agency or consultant? yes no what is your average monthly traffic? * up to 50k visitors/mo up to 100k visitors/mo up to 500k visitors/mo up to 1 million visitors/mo more than 1 million visitors/mo not sure by signing up you agree to our terms and privacy policy what's included all features in standard plans 1,000 visitor limit unlimited email tech support valid for 30 days from signup upgrade your trial account directly to a paid account after your trial expires. no campaign data will be lost during the upgrade. vwo does [a/b testing] so disruptively, embarrassingly better than google does that it puts a smile on my face. patrick mckenzie check your email! we've sent a message to yourmail@domain.com with an activation link in it. just click the link, and we'll take it from there. can't find the mail? check your spam, junk or secondary inboxes. still can't find it? let us know at support@vwo.com


Here you find all texts from your page as Google (googlebot) and others search engines seen it.

Words density analysis:

Numbers of all words: 1164

One word

Two words phrases

Three words phrases

test - 2.84% (33)
the - 2.41% (28)
you - 2.41% (28)
and - 2.41% (28)
testing - 2.15% (25)
our - 2.15% (25)
version - 1.55% (18)
a/b - 1.46% (17)
site - 1.29% (15)
your - 1.29% (15)
for - 1.29% (15)
conversion - 1.2% (14)
opt - 1.2% (14)
all - 1.2% (14)
vwo - 1.2% (14)
website - 1.12% (13)
page - 1.12% (13)
visitor - 1.03% (12)
use - 0.95% (11)
sign - 0.95% (11)
trial - 0.95% (11)
free - 0.86% (10)
email - 0.86% (10)
are - 0.86% (10)
sales - 0.86% (10)
webinar - 0.77% (9)
2017 - 0.77% (9)
increase - 0.77% (9)
visitors - 0.69% (8)
rate - 0.69% (8)
2016 - 0.69% (8)
incorrect. - 0.6% (7)
features - 0.6% (7)
user - 0.6% (7)
entered - 0.6% (7)
with - 0.6% (7)
view - 0.6% (7)
blog - 0.6% (7)
can - 0.52% (6)
february - 0.52% (6)
landing - 0.52% (6)
number - 0.52% (6)
how - 0.52% (6)
from - 0.52% (6)
april - 0.52% (6)
optimize - 0.52% (6)
28th, - 0.52% (6)
versions - 0.52% (6)
on-page - 0.43% (5)
more - 0.43% (5)
surveys - 0.43% (5)
visual - 0.43% (5)
studies - 0.43% (5)
password - 0.43% (5)
visitors/mo - 0.43% (5)
optimization - 0.43% (5)
case - 0.43% (5)
line - 0.43% (5)
optimizer - 0.43% (5)
[webinar] - 0.34% (4)
login - 0.34% (4)
sure - 0.34% (4)
get - 0.34% (4)
details - 0.34% (4)
car - 0.34% (4)
resources - 0.34% (4)
phone - 0.34% (4)
calculator - 0.34% (4)
heatmap - 0.34% (4)
request - 0.34% (4)
what - 0.34% (4)
27th, - 0.34% (4)
21st, - 0.34% (4)
report - 0.34% (4)
split - 0.34% (4)
pricing - 0.34% (4)
tool - 0.34% (4)
that - 0.34% (4)
guide - 0.34% (4)
image - 0.34% (4)
multivariate - 0.34% (4)
know - 0.34% (4)
heatmaps - 0.26% (3)
tech - 0.26% (3)
analyzer - 0.26% (3)
check - 0.26% (3)
idea - 0.26% (3)
target - 0.26% (3)
day - 0.26% (3)
work - 0.26% (3)
increased - 0.26% (3)
conversions - 0.26% (3)
account - 0.26% (3)
demo - 0.26% (3)
click - 0.26% (3)
enquiry - 0.26% (3)
software - 0.26% (3)
ebooks - 0.26% (3)
not - 0.26% (3)
ecommerce - 0.26% (3)
wingify. - 0.26% (3)
create - 0.26% (3)
product - 0.26% (3)
posted - 0.26% (3)
see - 0.26% (3)
tools - 0.26% (3)
address - 0.26% (3)
webinars - 0.26% (3)
support - 0.26% (3)
knowledge - 0.26% (3)
signup - 0.26% (3)
it's - 0.17% (2)
product. - 0.17% (2)
marketing - 0.17% (2)
their - 0.17% (2)
testing, - 0.17% (2)
using - 0.17% (2)
results - 0.17% (2)
million - 0.17% (2)
than - 0.17% (2)
limit - 0.17% (2)
full - 0.17% (2)
out - 0.17% (2)
privacy - 0.17% (2)
policy - 0.17% (2)
upgrade - 0.17% (2)
campaign - 0.17% (2)
can't - 0.17% (2)
find - 0.17% (2)
link - 0.17% (2)
sent - 0.17% (2)
does - 0.17% (2)
smile - 0.17% (2)
terms - 0.17% (2)
behavior - 0.17% (2)
consultant - 0.17% (2)
couple - 0.17% (2)
even - 0.17% (2)
here - 0.17% (2)
response - 0.17% (2)
tested - 0.17% (2)
simple - 0.17% (2)
set - 0.17% (2)
june - 0.17% (2)
right - 0.17% (2)
partners - 0.17% (2)
time - 0.17% (2)
new - 0.17% (2)
average - 0.17% (2)
drive - 0.17% (2)
call - 0.17% (2)
august - 0.17% (2)
2014 - 0.17% (2)
win... - 0.17% (2)
estimated - 0.17% (2)
beats - 0.17% (2)
slider: - 0.17% (2)
major - 0.17% (2)
achieved - 0.17% (2)
planning - 0.17% (2)
optimisation - 0.17% (2)
[webinar]: - 0.17% (2)
download - 0.17% (2)
26% - 0.17% (2)
visits-to-order... - 0.17% (2)
headline - 0.17% (2)
killer - 0.17% (2)
november - 0.17% (2)
22nd, - 0.17% (2)
by... - 0.17% (2)
relevant - 0.17% (2)
making - 0.17% (2)
cta - 0.17% (2)
2013 - 0.17% (2)
removing - 0.17% (2)
26th, - 0.17% (2)
2015 - 0.17% (2)
march - 0.17% (2)
7.8%... - 0.17% (2)
header - 0.17% (2)
effected - 0.17% (2)
for... - 0.17% (2)
do's - 0.17% (2)
also - 0.17% (2)
$0k - 0.17% (2)
message - 0.17% (2)
other - 0.17% (2)
name - 0.17% (2)
technical - 0.17% (2)
different - 0.17% (2)
sales. - 0.17% (2)
targeting - 0.17% (2)
measure - 0.17% (2)
analysis - 0.17% (2)
feedback - 0.17% (2)
included - 0.17% (2)
research - 0.17% (2)
easy - 0.17% (2)
required - 0.17% (2)
convert - 0.17% (2)
mobile - 0.17% (2)
wolf - 0.17% (2)
talia - 0.17% (2)
don'ts - 0.17% (2)
moderated - 0.17% (2)
visitors... - 0.17% (2)
duration - 0.17% (2)
credit - 0.17% (2)
card - 0.17% (2)
plans - 0.17% (2)
personalize - 0.17% (2)
significance - 0.17% (2)
ideafox - 0.17% (2)
segment - 0.17% (2)
a/b test - 1.37% (16)
a/b testing - 1.03% (12)
entered is - 0.6% (7)
free trial - 0.6% (7)
is incorrect. - 0.6% (7)
you entered - 0.6% (7)
view all - 0.6% (7)
landing page - 0.52% (6)
conversion rate - 0.52% (6)
website optimizer - 0.43% (5)
on-page surveys - 0.43% (5)
visual website - 0.43% (5)
case studies - 0.43% (5)
2017 how - 0.34% (4)
february 28th, - 0.34% (4)
multivariate testing - 0.34% (4)
phone number - 0.34% (4)
details » - 0.34% (4)
28th, 2017 - 0.34% (4)
2016 view - 0.34% (4)
increase in - 0.34% (4)
testing software - 0.26% (3)
split testing - 0.26% (3)
trial login - 0.26% (3)
page analyzer - 0.26% (3)
posted in - 0.26% (3)
your conversion - 0.26% (3)
what is - 0.26% (3)
up for - 0.26% (3)
email address - 0.26% (3)
features pricing - 0.26% (3)
visitors/mo up - 0.26% (3)
request demo - 0.26% (3)
the email - 0.26% (3)
a free - 0.26% (3)
pricing blog - 0.26% (3)
duration calculator - 0.17% (2)
ideafox landing - 0.17% (2)
email * - 0.17% (2)
significance calculator - 0.17% (2)
talia wolf - 0.17% (2)
optimisation for... - 0.17% (2)
2017 [webinar] - 0.17% (2)
do's and - 0.17% (2)
[webinar]: planning - 0.17% (2)
all webinars - 0.17% (2)
surveys | - 0.17% (2)
download guide - 0.17% (2)
april 21st, - 0.17% (2)
don'ts of - 0.17% (2)
moderated user - 0.17% (2)
webinar | - 0.17% (2)
convert mobile - 0.17% (2)
visitors... april - 0.17% (2)
check your - 0.17% (2)
vwo and - 0.17% (2)
testing february - 0.17% (2)
27th, 2017 - 0.17% (2)
28th, 2016 - 0.17% (2)
your trial - 0.17% (2)
on june - 0.17% (2)
vwo free - 0.17% (2)
conversion optimization - 0.17% (2)
in a/b - 0.17% (2)
results is - 0.17% (2)
of the - 0.17% (2)
trial free - 0.17% (2)
vwo for - 0.17% (2)
name * - 0.17% (2)
million visitors/mo - 0.17% (2)
incorrect. password - 0.17% (2)
address you - 0.17% (2)
privacy policy - 0.17% (2)
password you - 0.17% (2)
with vwo - 0.17% (2)
test drive - 0.17% (2)
1 million - 0.17% (2)
$0k sales - 0.17% (2)
blog resources - 0.17% (2)
you can - 0.17% (2)
the phone - 0.17% (2)
number you - 0.17% (2)
0% conversion - 0.17% (2)
sales 0% - 0.17% (2)
rate optimization - 0.17% (2)
all features - 0.17% (2)
that all - 0.17% (2)
different versions - 0.17% (2)
2016 on-page - 0.17% (2)
can't find - 0.17% (2)
ebooks on-page - 0.17% (2)
visits-to-order... april - 0.17% (2)
27th, 2016 - 0.17% (2)
| download - 0.17% (2)
26% more - 0.17% (2)
major achieved - 0.17% (2)
all ebooks - 0.17% (2)
report 2016 - 0.17% (2)
an ecommerce - 0.17% (2)
guide april - 0.17% (2)
21st, 2016 - 0.17% (2)
[webinar] do's - 0.17% (2)
and don'ts - 0.17% (2)
of moderated - 0.17% (2)
for... february - 0.17% (2)
conversion optimisation - 0.17% (2)
webinars [webinar]: - 0.17% (2)
planning your - 0.17% (2)
2014 view - 0.17% (2)
august 21st, - 0.17% (2)
conversions by... - 0.17% (2)
november 22nd, - 0.17% (2)
2013 removing - 0.17% (2)
relevant increased - 0.17% (2)
cta more - 0.17% (2)
resources request - 0.17% (2)
demo free - 0.17% (2)
studies making - 0.17% (2)
a line - 0.17% (2)
from header - 0.17% (2)
beats image - 0.17% (2)
slider: an - 0.17% (2)
estimated win... - 0.17% (2)
killer headline - 0.17% (2)
26th, 2015 - 0.17% (2)
image effected - 0.17% (2)
7.8%... march - 0.17% (2)
user testing - 0.17% (2)
february 27th, - 0.17% (2)
headline beats - 0.17% (2)
image slider: - 0.17% (2)
an estimated - 0.17% (2)
2015 killer - 0.17% (2)
march 26th, - 0.17% (2)
line from - 0.17% (2)
header image - 0.17% (2)
effected 7.8%... - 0.17% (2)
win... august - 0.17% (2)
21st, 2014 - 0.17% (2)
ecommerce major - 0.17% (2)
achieved 26% - 0.17% (2)
more visits-to-order... - 0.17% (2)
how an - 0.17% (2)
2016 february - 0.17% (2)
you are - 0.17% (2)
surveys report - 0.17% (2)
removing a - 0.17% (2)
22nd, 2013 - 0.17% (2)
mobile visitors... - 0.17% (2)
april 28th, - 0.17% (2)
all a/b - 0.17% (2)
| convert - 0.17% (2)
wolf webinar - 0.17% (2)
2017 vwo - 0.17% (2)
and talia - 0.17% (2)
testing duration - 0.17% (2)
calculator a/b - 0.17% (2)
more relevant - 0.17% (2)
increased conversions - 0.17% (2)
by... november - 0.17% (2)
making cta - 0.17% (2)
credit card - 0.17% (2)
testing significance - 0.17% (2)
calculator ideafox - 0.17% (2)
april 27th, - 0.17% (2)
entered is incorrect. - 0.6% (7)
you entered is - 0.6% (7)
visual website optimizer - 0.43% (5)
2016 view all - 0.34% (4)
landing page analyzer - 0.26% (3)
for a free - 0.26% (3)
free trial login - 0.26% (3)
visitors/mo up to - 0.26% (3)
a/b testing duration - 0.17% (2)
calculator a/b testing - 0.17% (2)
significance calculator ideafox - 0.17% (2)
| convert mobile - 0.17% (2)
testing february 27th, - 0.17% (2)
2017 vwo and - 0.17% (2)
talia wolf webinar - 0.17% (2)
visitors... april 28th, - 0.17% (2)
the phone number - 0.17% (2)
work email * - 0.17% (2)
the email address - 0.17% (2)
the password you - 0.17% (2)
1 million visitors/mo - 0.17% (2)
email address you - 0.17% (2)
different versions of - 0.17% (2)
* the email - 0.17% (2)
of moderated user - 0.17% (2)
sales 0% conversion - 0.17% (2)
0% conversion rate - 0.17% (2)
credit card required - 0.17% (2)
28th, 2017 [webinar] - 0.17% (2)
7.8%... march 26th, - 0.17% (2)
header image effected - 0.17% (2)
2015 killer headline - 0.17% (2)
beats image slider: - 0.17% (2)
an estimated win... - 0.17% (2)
a line from - 0.17% (2)
22nd, 2013 removing - 0.17% (2)
demo free trial - 0.17% (2)
blog resources request - 0.17% (2)
studies making cta - 0.17% (2)
more relevant increased - 0.17% (2)
conversions by... november - 0.17% (2)
august 21st, 2014 - 0.17% (2)
view all ebooks - 0.17% (2)
21st, 2016 view - 0.17% (2)
download guide april - 0.17% (2)
all webinars [webinar]: - 0.17% (2)
planning your conversion - 0.17% (2)
optimisation for... february - 0.17% (2)
on-page surveys | - 0.17% (2)
april 27th, 2016 - 0.17% (2)
2016 february 28th, - 0.17% (2)
on-page surveys report - 0.17% (2)
2017 how an - 0.17% (2)
ecommerce major achieved - 0.17% (2)
26% more visits-to-order... - 0.17% (2)
do's and don'ts - 0.17% (2)

Here you can find chart of all your popular one, two and three word phrases. Google and others search engines means your page is about words you use frequently.

Copyright © 2015-2016 hupso.pl. All rights reserved. FB | +G | Twitter

Hupso.pl jest serwisem internetowym, w którym jednym kliknieciem możesz szybko i łatwo sprawdź stronę www pod kątem SEO. Oferujemy darmowe pozycjonowanie stron internetowych oraz wycena domen i stron internetowych. Prowadzimy ranking polskich stron internetowych oraz ranking stron alexa.