1.23 score from hupso.pl for:
visualwebsiteoptimizer.com



HTML Content


Titleworld's easiest a/b and split testing software - visual website optimizer.

Length: 74, Words: 12
Description vwo is the easiest a/b, split and multivariate testing tool. try a free 30-day trial to start optimizing your website for increased conversion rate and sales.

Length: 158, Words: 27
Keywords pusty
Robots
Charset UTF-8
Og Meta - Title pusty
Og Meta - Description pusty
Og Meta - Site name pusty
Tytuł powinien zawierać pomiędzy 10 a 70 znaków (ze spacjami), a mniej niż 12 słów w długości.
Meta opis powinien zawierać pomiędzy 50 a 160 znaków (łącznie ze spacjami), a mniej niż 24 słów w długości.
Kodowanie znaków powinny być określone , UTF-8 jest chyba najlepszy zestaw znaków, aby przejść z powodu UTF-8 jest bardziej międzynarodowy kodowaniem.
Otwarte obiekty wykresu powinny być obecne w stronie internetowej (więcej informacji na temat protokołu OpenGraph: http://ogp.me/)

SEO Content

Words/Characters 1165
Text/HTML 12.33 %
Headings H1 1
H2 5
H3 10
H4 4
H5 0
H6 0
H1
a/b testing software for marketers
H2
how it works
trusted by thousands of leading brands
the proof is in the numbers
as seen on
from the blog
H3
case studies
ebooks
webinars
case studies
ebooks
webinars
talk to a sales representative
write to us
tools included
what is visual website optimizer?
H4 testing & experimentation
research & user feedback
analytics & reporting
targeting & personalization
H5
H6
strong
$
$
a/b testing software
b
$
$
a/b testing software
i
$
$
a/b testing software
em
Bolds strong 3
b 3
i 3
em 0
Zawartość strony internetowej powinno zawierać więcej niż 250 słów, z stopa tekst / kod jest wyższy niż 20%.
Pozycji używać znaczników (h1, h2, h3, ...), aby określić temat sekcji lub ustępów na stronie, ale zwykle, użyj mniej niż 6 dla każdego tagu pozycje zachować swoją stronę zwięzły.
Styl używać silnych i kursywy znaczniki podkreślić swoje słowa kluczowe swojej stronie, ale nie nadużywać (mniej niż 16 silnych tagi i 16 znaczników kursywy)

Statystyki strony

twitter:title pusty
twitter:description pusty
google+ itemprop=name pusty
Pliki zewnętrzne 6
Pliki CSS 1
Pliki javascript 5
Plik należy zmniejszyć całkowite odwołanie plików (CSS + JavaScript) do 7-8 maksymalnie.

Linki wewnętrzne i zewnętrzne

Linki 134
Linki wewnętrzne 94
Linki zewnętrzne 40
Linki bez atrybutu Title 130
Linki z atrybutem NOFOLLOW 0
Linki - Użyj atrybutu tytuł dla każdego łącza. Nofollow link jest link, który nie pozwala wyszukiwarkom boty zrealizują są odnośniki no follow. Należy zwracać uwagę na ich użytkowania

Linki wewnętrzne

vwo
call sales tel:+1-844-822-8378
free trial /free-trial/
login /login/
menu #
features /features/
pricing /pricing/
blog /blog/
resources /resources/
request demo /request-demo/
free trial /free-trial/
login /login/
features /features/
pricing /pricing/
blog /blog/
visual website optimizer
resources /resources/
case studies /resources/casestudy/
view all /resources/casestudy/
ebooks /resources/ebook/
view all /resources/ebook/
webinars /resources/webinar/
view all /resources/webinar/
a/b testing duration calculator /ab-split-test-duration/
a/b testing significance calculator /ab-split-test-significance-calculator/
ideafox /ideafox/
request demo /request-demo/
login /login/
plans start at $49/month /pricing/
sign up for a free account /free-trial/
case studies /resources/casestudy/
view all /resources/casestudy/
ebooks /resources/ebook/
view all /resources/ebook/
webinars /resources/webinar/
view all /resources/webinar/
a/b testing duration calculator /ab-split-test-duration/
a/b testing significance calculator /ab-split-test-significance-calculator/
ideafox /ideafox/
+1 844-822-8378 tel:+1-844-822-8378
sales@wingify.com mailto:sales@wingify.com
vwo
features /features/
pricing /pricing/
blog /blog/
resources /resources/
request demo /request-demo/
free trial /free-trial/
login /login/
view all features features/
a/b testing ab-testing/
point-and-click editor features#visual-editor
thousands of enterprises pricing/
case studies resources/casestudy/
signup for a free 30 day trial free-trial/
62%
increase in inquiries
multivariate testing
hyundai

korean car maker increased test drive requests for test drives

details »
/blog/multivariate-testing-case-study/
158%
increase in trial signups
a/b testing
get response

the leader in email marketing a/b tested call to action buttons

details »
/blog/a-b-testing-free-trial-button/
41%
increase in sales
a/b testing
smiley cookie

the us based ecommerce store tested the next shipping v/s other offers

details »
/blog/ecommerce-increase-sales-2/
25%
increase in registrations
heatmap
pair

the popular app for couples ran heatmaps on their landing page

details »
/blog/increase-conversions-using-heatmaps/
features /features/
pricing /pricing/
faqs /faqs/
knowledgebase /knowledge/
on-page surveys /on-page-surveys/
visitor behavior analysis /visitor-behavior-analysis/
smartstats /bayesian-ab-testing/
integrations /integrations/
compare vwo /compare-visualwebsiteoptimizer/
free trial /free-trial/
free trial /free-trial/
blog /blog/
case studies /resources/casestudy/
guides & ebooks /resources/ebook/
videos & webinars /resources/webinar/
a/b testing guide /ab-testing/
split testing with vwo /pages/vwo-split-testing-tool/
free tools /resources/free-tool/
vwo for marketers /pages/
what is multivariate testing /pages/multivariate-testing/
conversion rate optimization /pages/conversion-rate-optimization/
about us /about-us/
careers /careers/
partners /partners/
contact us /contact-us/
terms of use /terms-conditions/
privacy policy /privacy-policy/
opt out /opt-out/
日本語 /jp/
sign up /free-trial/
#
#
terms /terms-conditions/
privacy policy /privacy-policy/
support@vwo.com mailto:support@vwo.com

Linki zewnętrzne

here https://vwo.com/?pagespeed=noscript
making cta more relevant increased conversions by... https://vwo.com/blog/increase-relevance-to-boost-conversions/
removing a line from header image effected 7.8%... https://vwo.com/blog/dutch-major-achieved-7-8-increase-conversion-removing-line/
killer headline beats image slider: an estimated win... https://vwo.com/blog/image-slider-ab-test/
key pillars of a successful conversion optimization program http://resource.vwo.com/key-conversion-optimization-pillars-ebook
vwo ecommerce cart abandonment report 2016 http://resources.vwo.com/cart-abandonment-report
how an ecommerce major achieved 26% more visits-to-order... http://resources.vwo.com/shopclues-vwo-cro-case-study
vwo and talia wolf webinar | convert mobile visitors... http://resources.vwo.com/webinar-with-talia-wolf-convert-mobile-visitors-into-customers
vwo and spfu webinar | running smarter retargeting... http://resources.vwo.com/webinar-retargeting-campaigns-from-ad-to-landing-page
vwo and getresponse | cro webinar http://resources.vwo.com/webinar-10-conversion-killers-and-their-hacks
landing page analyzer http://landingpageanalyzer.io
play https://www.youtube.com/watch?v=pmxrjt6fud4
making cta more relevant increased conversions by... https://vwo.com/blog/increase-relevance-to-boost-conversions/
removing a line from header image effected 7.8%... https://vwo.com/blog/dutch-major-achieved-7-8-increase-conversion-removing-line/
killer headline beats image slider: an estimated win... https://vwo.com/blog/image-slider-ab-test/
key pillars of a successful conversion optimization program http://resource.vwo.com/key-conversion-optimization-pillars-ebook
vwo ecommerce cart abandonment report 2016 http://resources.vwo.com/cart-abandonment-report
how an ecommerce major achieved 26% more visits-to-order... http://resources.vwo.com/shopclues-vwo-cro-case-study
vwo and talia wolf webinar | convert mobile visitors... http://resources.vwo.com/webinar-with-talia-wolf-convert-mobile-visitors-into-customers
vwo and spfu webinar | running smarter retargeting... http://resources.vwo.com/webinar-retargeting-campaigns-from-ad-to-landing-page
vwo and getresponse | cro webinar http://resources.vwo.com/webinar-10-conversion-killers-and-their-hacks
landing page analyzer http://landingpageanalyzer.io
- http://www.smashingmagazine.com/2010/06/24/the-ultimate-guide-to-a-b-testing/
- http://thenextweb.com/dd/2013/12/09/5-ways-improve-websites-conversion-rate/
- http://mashable.com/2010/11/04/a-b-testing-resources/
- http://forbesindia.com/article/30-under-30/paras-chopra-making-websites-fly/37201/1
- http://techcrunch.com/2014/06/25/wingify-launches-a-new-ab-testing-platform-for-people-without-coding-experience/
-
posted in conversion optimization on november 29th, 2016
https://vwo.com/blog/how-to-increase-conversion-rate/
-
posted in conversion optimization on november 15th, 2016
https://vwo.com/blog/vwo-evolves-into-a-conversion-optimization-platform/
-
posted in a/b split testing on october 31st, 2016
https://vwo.com/blog/aa-test-before-ab-testing/
team blog http://team.wingify.com/
engineering blog http://engineering.wingify.com/
http://wingify.com
https://www.facebook.com/visualwebsiteoptimizer/
https://twitter.com/vwo
https://plus.google.com/+visualwebsiteoptimizer
https://www.linkedin.com/company/vwo---a-b-testing-&-conversion-optimization-platform?trk=company_name
wingify http://wingify.com/
english https://vwo.com/
forgot password? https://app.vwo.com/#/forgot-password

Zdjęcia

Zdjęcia 33
Zdjęcia bez atrybutu ALT 25
Zdjęcia bez atrybutu TITLE 33
Korzystanie Obraz ALT i TITLE atrybutu dla każdego obrazu.

Zdjęcia bez atrybutu TITLE

https://vwo.com/blog/wp-content/uploads/2014/04/xpricecharting-logo.gif.pagespeed.ic.nik3hfafou.png
https://vwo.com/blog/wp-content/uploads/2015/03/xvvaa-false-button.jpg.pagespeed.ic.fmux2bnjuw.jpg
https://vwo.com/blog/wp-content/uploads/2014/08/xmeddelandelan_logo.png.pagespeed.ic.w9ac6fxwmu.png
//go.pardot.com/l/159891/2016-09-23/9l4mm/159891/16484/ebook_icon.png
//go.pardot.com/l/159891/2016-06-30/2ndcp/159891/10606/icon.png
//go.pardot.com/l/159891/2016-06-29/2n2w9/159891/10472/shopclues_logo_2.png
//go.pardot.com/l/159891/2016-06-29/2n2vw/159891/10460/vwo_inflow_ebook.png
//go.pardot.com/l/159891/2016-06-29/2n2vw/159891/10460/vwo_inflow_ebook.png
//go.pardot.com/l/159891/2016-06-29/2n2vr/159891/10458/getresponse.png
https://vwo.com/blog/wp-content/uploads/2014/04/xpricecharting-logo.gif.pagespeed.ic.nik3hfafou.png
https://vwo.com/blog/wp-content/uploads/2015/03/xvvaa-false-button.jpg.pagespeed.ic.fmux2bnjuw.jpg
https://vwo.com/blog/wp-content/uploads/2014/08/xmeddelandelan_logo.png.pagespeed.ic.w9ac6fxwmu.png
//go.pardot.com/l/159891/2016-09-23/9l4mm/159891/16484/ebook_icon.png
//go.pardot.com/l/159891/2016-06-30/2ndcp/159891/10606/icon.png
//go.pardot.com/l/159891/2016-06-29/2n2w9/159891/10472/shopclues_logo_2.png
//go.pardot.com/l/159891/2016-06-29/2n2vw/159891/10460/vwo_inflow_ebook.png
//go.pardot.com/l/159891/2016-06-29/2n2vw/159891/10460/vwo_inflow_ebook.png
//go.pardot.com/l/159891/2016-06-29/2n2vr/159891/10458/getresponse.png
/images/page_home/how_it_works/mobile.png.pagespeed.ce.qrcgpav5pm.png
/images/page_home/map/xmap-new.jpg.pagespeed.ic.3d4wt1odw5.jpg
/images/testimonials/scott_swanson.jpg.pagespeed.ce.tfog9refsk.jpg
/images/testimonials/xroger_elliot.jpg.pagespeed.ic.qckqxrfgjw.jpg
/images/testimonials/xsunit_singh.jpg.pagespeed.ic.rg9jd9mflx.jpg
/images/logos_media/sm,402x.png.pagespeed.ce.yahbm4lwcn.png
/images/logos_media/the_next_web,402x.png.pagespeed.ce.oe-mifkp5o.png
data:image/png;base64,ivborw0kggoaaaansuheugaaauyaaabqcamaaabs8szwaaaapfbmveuaaaaaar4ae8yaemuadmmafmgaesuafskafcgafckafskafcoafskafskafcgafcgatryafcgafmgaf8qgvtd3aaaae3rstlmad0krhhe3zyr+47db75tzbmv9wplnnqaaca5jrefuenrtnnmo3samhoctoldd+79rl6p2gbestkuqvfnvqngaflenge4/tra2tra2tra2trb+t6ljupkttypjklqy1qo1/vhhffug3/mwrx9kr6znao0+/lh94xhlbqk9p0ntjjnsb0pk5upqg+ok8xaghqzkxgigd3tcgi02xledqvexjaq3xkefa7juf0hqyxyk+x1hs9jo2bhbuelvo6zlxgi6gvlqqbjgewmcjduhaowc5bib46dcrwnwudzmywtxiuru2lsnewxpkm7zxpoon8zbbuiiwrqkyqknvx+j+nmy0wagjd6cpkfx9rsjhbdupseh2msmkgblzdkkygop8ftolorxortwxh5pm4wuk4zlan7gal3rhchpnlfnv1nvqr6bsuj3atmdzzdqmr4h47fhdi/ituxzzoghdluf7uvkhgoxxlikhbgzmtwawshmhmwkbiqncho6u2umakrzsd/fkmz8frfpdpvxmrnkkum6jkch3wkndkjxl42yc4xcmkhvppddd1jj8bifg9zncbgvh+0ek5kmhkzdzc88yow/kifoypx51rnchdcwtckonpztz1u5jiropqprjjiz9uj5u/8rqaixlubrjhevwp7nkbdmbebq20qn0jujr2nuphfuvxhz53sqdbi8jk7hxzf9oddqvljcyqery4y0s9kcvggjq2gmnlvayzsdl6l2exjcixu8pm8zrgel43yirxelgjgxay1xuhgjr7osmla+ubteeotomb7pqcemuymfpcn9fycwjwleaoykuqay13iljedfkhfmx+sbbxegjw7qxk/u6pxcjuyurnjjjxi7yjgkoduu95zmj3juzskdpjgpoiuhvczud62fku6kpcj1us0fstaxpxya0ykmfboqd61vdvpj4rfgz2l0k5n+ttabr+e0pkcabbahcfkghkbn0yh2ss4og8afsana2qwh0ttn6ah+mdtx21istsmyq1zavy/ckcf4kfleyk+uc9cs5zc5yk+q/f2dhguj9meewzg/mine8yirmjq7swpua4edxhjljz5bwdggo6chbzchmbihto7htmmymfbhjsd6o4mvtecueuboz6wqnwlxnwlmeniyfvojkxfofe2zgjoc/apcjgzznxpuyhi0a4ysou4ln6/rbaljwr/skrkj486thww1aywotgtnhuu4glh0ibnpfi55fnwkrjeg7pocznxexi07cqjwjuzq6hzjphg/odsagp3awm4vw5qshcqomz+59yqa8vxfemnmd91qec7rnwkmcng+lcimmvuzaam9gcgvczbkemke+7ole37rsv9coxyyffvczfxldz2tqbjf4rttuhjridhll/jx1rrbgswcvwurrwdelneyi4mdl2s2pqcrt6rfecnac7hrjodqnrepjknfegh/c1uvl6jjibl0zrx+wmpgdsof0zvgizecx7md0s4p6cmm4t5glnap0d0etiqo2apytoqqwgoumqycowj9icawvhvtciznpzb6uoq7h1c/meyltg+szjk2l5/akgz/vyz6emo/jzcjjlqzegefsdjeccnygjccbxmmsdj+mzf+fb4jacuhncpt9dfqveri1qbvcvdzdet0gcp+inh6fb7lrvubmsrw5ezwvyfsez2aoxxvby6xvidxoghihxgv/a5swc96jfea0zjggg9rjkcttqhmf8qf3lzr6z3m7p4pcmr4idhhs8dngdmywwengit2ns+5xymkhgwdmkmxjhivjzb9cgnhdgllo3vjwu9i4jat1mq+qrxmjrumpknlj54yn1ixuxcbiye9vatzw11i9kbtyvxpzevgl4vfvhgkywp/5lujvmvxbhkad5w4rsfxo/kd9pqio2hknnwnus5w3wefuqix4dwobgj/ivmbjw9lxlkpjpxrhccycrwor87xydfct8uy9e3rni6iyph7cbp8wsy4blrwynlpy/qmxs5ixaxsbvweyusojwxgrnkpfnm0rgm6noptyoxwgohz3ki/xcuyktswnpjpjbukbvaele5f8tsxolkpzjfen3j0qts8fbngttznmqaujxim3b/a1qks/qqnucxm8prhzkexs2jkozgycsadss+rnxyxe7wgmbl4mysjtf78fno9ejxqyaqxoyxnhmr9hjtgtejprmq3hbml8z0twzj0m/+jlda7nnvdq/hqti4stu+mcr708aijgj7wtiodseomvklgmiqbfy5omlklfoadk5fvwctg9xh7a4zafok5rslfpql9rycpckubxlwi3c2rmqsldmddjkzfs4go4pvwn8psx2ujsyeb0rgtyk6cghgjjoyhgew/1gewnqxdlrxgei6chs4ykal+nowwkq2uyoh9kf8ezzdeczm5m51cofixviza/pubiwzwfdaghe6ev1dmd4b7esh3eua+auwcsmh5tgks632jkqkk/nafzuz+lpyehmduyoxbryl+iuaoo5litxmc8pt3nnd+iadcxrzd/s4lhx/yyo+bwopvrd3wkam2j38y+bwjpo30ctfy6/xpktp6hsv462cp4xwn7bbvuy87cuh9rck78fll+lb74buuanxvjldc0lsy+rsdyvusrkb3b3z4qw/ekn+p1xfrepwndxadyd9igw8ruiw+frekbc55z2rzmulcm0vjtzovthwuivtkydxjqvoquprsy+p5d1pw05z7nnj5z/4fzltbw1tbw1tbw1tbw18awlz2grdg/10aaaaasuvork5cyii=
data:image/png;base64,ivborw0kggoaaaansuheugaaapqaaabqcamaaaazfkg0aaaanlbmveuaaaatxpkux5ssxzguyjssxpkuyjsswpcux5ovrjauyjsux5omvzyux5stxjguyjswyzwuyjuolbhbaaaaehrstlmacsjs42lymjam0omdoegzdiuprgaabnfjrefuenrtm+t62yamhs0zzmm6/5vd2savqwcil3v59vj7syxgofciweb0uxxr1q1bt27dunvrwvxsdl2xh5feonb2uon7vrxkqfgsp4fsy49re0ryrbwcu/wx0hjm+lodm5a+f17ospunowf7a+gpsdqqucvz8slyx0pwkixzb2rlo4qeajxodiyvkic3ghzl0phqanwt9mleanopozgtk+gl0a7eapqvs5pc97imxyh+ftciglynm18khd8c2oygg/684paxyl8ftbtbl+qv0owtobcyqs/6hddqpad1edp3zyf8v9byco3+p+ivqbpzi7rlyltrprmdpxgl9luejzeqgw+l56gn+bjwk+nonumcfvpggl2bdrct4et/xr5fx9tjtsvspy77rmyzgxbjcqkbylxihezxwnuyanqomhxn48zmlmssa+g+/sl0p8qq+x68wooitbo1tlfqdeww0wmfzclietyika5co9x3x5jnjfknzm/cerhabyixlgldqw0oplohnotyu6gtmgue+uhjtdwphxjwc8rsq4laovy4jhrxts2zwsf0w+cjp/n+srvw2bx8oox7chr5hzovj20b1xqiqlgotf9e6qmcrxf7osv/kdynpksg48byt62pbcgfh+zh6askia9vc8jcce2kj6ag/sxdjkj3gqvdocm1ci563xtxpg2tipsn0aabyfxjep8paslzppvqc3qotmnltka9bwo/8lrgx6eh8taedpo4uixnqkmoinniosm1dmgcjfpedjx8o0jkfehwlmvt5v96ipxbm7yy2aobluio7qloqa5qrxpj0tvyswi3ivqxakf3wgbqqlyycqpohnnfkiflrzdrkv91ymqiaxpapix4vbswnog9a4jc2r8avyyewzjsxvnoen7dso+xeqqhqztzxexroeg1z76uunwwmv6dgo63orp/0ea7pv+xm+iw0e95j9wgejqb1jzod6gpenpwoycs9arv13cugixj6k9k7zcyycx0bqy808x/ak2r4vf5q0xanzqhpqnmklvosqbcqw9qunktc9dwwzw0izpqflvwhbouwmi199dji7lxtqiixfle5oirerbakzxbzj+gdcemoemidhwccy6eyayr8jx+hmgph1kjdmg6nshf783xobc4wlqziufxkwchb0nlnofgeln1a31yao6fhea9ozraidqx6b1y9u4s9jj3ae2g2yvreuj0bpralai4c63al5i7am12dvl6qzd+xghd9qmtkf9uqaaimeahuximbsh0nideirkemjakcrjndewctp8b0gkkgiogjkov1q0t9jx0gi/obrlaxosm4q3ecvt09i4k0owdqefqmdz/dvpwo8tccsmz3l7xl8+9zd/nid6bl0lrkspzmkupsw1rtsumto2gwhhazdynu28e6urxk65hcopmtnhpk0fqtl+gcjidv6fnnvketx0ssu7gtx71rvobdkuw3gc6yjfng4tjx5wfuzq1xiaz99n59fuf1n1w5myuax7aku/lvhwrghasmddzmyo+igxwhud8etqngdfvm+ujo8nxjqhdnuzcduof09w+nhchoh20achxsplkwwxhxmkcqqfxryfnd3xpwhse2k9c03vca+rqce9gqgustgdwuk9renooeginh4ftgjk42axtni7vdag160zmnppjbbpfa2st+fyciinhqxon2wlgujlmddj7s11omxuu6eenji2jwtla0+iyoh76d6urulokmpyjtbangltss+iqh6fjoityonnhna3vq2j6biwrpyfk4ghxenfj9ibahl0x3gb5uwo1abqfzg+izmojp9car5cwj2jdxw098zhrfzmlraz2ek2dsgn4o5vcakycwciizuxdo1rnljlsu3f3sdewn4qz9xyfekqg2hdy4u7da6ymilb1eyiy9vwzegib43qmvnromccqx+qohgd5fddt9dav5ptbyhsuurjqw5qae1qqppwgo2isa35sotvj07mg02wqzlbzuzw85firism8rsbjrpbnp062qbthnzogax8csw0o8hdopjm+1yfh6ukjj89uhn3tfapisvkojdcyzunkszjm+ijze9qh9mf5oykkun/w6dwqclwtxgxe5adx9monojjfwwli7fprsuufl5hh03qnzcy3bt26devwrvu33k2/adyba9ncnwewaaaaaelftksuqmcc
data:image/png;base64,ivborw0kggoaaaansuheugaaahgaaabqcamaaadlrug7aaaanlbmveuaaaaalgaatwaa3gaaaaaaywaalqaavwaavqaazaaa3waaaaaagaaawaaamaaazaaa5aaalabm3wflaaaadxrstlma9t7oaftq6/fo+gicbvmxxqaaagrjrefuan7t2nf2mzamggegssvvk5je/2vn09qapnzqa4gt1v9voq35iheeyddr9xrv19+va/lpx9qqiwnziceh18hs4tngyebxibhwsapgusvzzsk+blirgrki81mw+rgwybghjwfx7td5udfvxbzudp61nuexdtdqzvw94v/ka92g7fayd8uqgagmbazeihvkws6uwhzkthegswcilzstxkezko3zog63igfixuex8fgi4ztklmwyowmd7lgcjzmrkrx6nzyuqyyyt8omdb6tysjayxt8z8cudgf6q5nuy3ohhhitexaxy4n+l4/ld1/k/yspa0xyn+xpi8wvgyc6whbb4emdgojpydwotlc6h4owa1fc/b3ogc6ab+sbtn6pic6ewtjnvv0whbgfno+bsrk2x8bwwrkrlmjlkovh8kv33a8j/r8um8ubu8cf2mwfnxkrcnanphf4fjgv9nc9o2fhyx4o67xkigfjofyxkptzesa8hg6bg2e8goywwkqcvs6ffdzrekqb1xvhpnor05v4hfwkcx3gq4plx8ibyypvwhgvdffbuwns7ewze+bjwkuavs98fldrpzdwnphlmfxc9n4wvhp2jg9p/jhuwewbeymgfpz4n2cc74gn1qjsfxdt1atih3g6azahwlyddvrrvgw3wrijdgpdee71er236x/kx/a44x32baaaaabjru5erkjggg==
/xresample.php,qq=https,3a,_,_vwo.com,_blog,_wp-content,_uploads,_2016,_11,_ibm.png.pagespeed.ic.dz--nwodoi.jpg
https://vwo.com/blog/wp-content/uploads/2016/11/blog-cta.png.pagespeed.ce.zqns-mjtca.png
/xresample.php,qq=https,3a,_,_vwo.com,_blog,_wp-content,_uploads,_2016,_10,_a.jpg.pagespeed.ic.t43ltwrlyu.jpg
data:image/png;base64,ivborw0kggoaaaansuheugaaakqaaabicamaaabp7a6kaaaaqlbmveuaaaaeiscdicyufh0eiccaaaidisyeiscrfx0eiscbhsizhcedicydiccchyudiccchyqeisceicyfiscgiykeisdmmbf/aaaafhrstlma8lyzqav0xa/ylingheioposytwrwzqqaaautsurbvgje7zrrdqmgeic5i3hbnl7/q26ajaoijdn2dm2ezi8mbowpyw5qirdj3xq7okzoghjfzpckfhdomja2t0tl4ynn28vljst4taamkwskz/qotxpipammfxxtks1x97+mxfbyhc8rv9qxxoso3k838azjliye7wp5gbys/aeq3eygs3imsps6fd41cg3twlqooqn6tj7kzndwox85pqhzdc2jmmohuyjojmlruvt6dbkl3wn6dkwhmqzxs0zxvcjje6i0006hkmu2+gwsxwyrmj76hes+zcr8jaxeymuq0gidydqky5h210zhy8i1bvsopkxacmuwoyqegbapmk3qo/jsjixl68qoiun3kyfixtue3c/xsc3dpsrotzlzgtwpgw3kwfl2h5cwmuecjuj5ruvhct2ounyone8ecgjxrohhuiopi7kkpmvoiyl0n1dbtrgzx1oacnxecuk21ekqqy+u/uggherjc4hk++ezmldfqbigd+aqe2kyk1lhx9h9v4eem8z5g9cwtq8odktbi9qxkdrcaw4y++cdftgaalsjcrw1ym5xw4fzjmigiowxltmhtjyhjklfyiejbybfmm0l2cwcqylrmt64oqp46eykx0mcqrbgdkdjj9nkvgio21ftosdfxhhgn5xdajwsgtgeq7oahjb0u4jze0nbyd0ixa9cb4/ntz6iitsfqsov/ahbzi6vuv1znksk4/bj2r6hs+xwjfg4djij17uercxrzeq09yjvrsrhrb5eqthi0cgoocztqwgztvnab7mwh4hswfbqjgh2uck3z5ajzay+p9j8hxltjeprdcqvpkc5hispictazxvfgrn+e7jrujg535srvo9nqck1ldrotgnt4blonxwluvjjqxzuneqsveorkfl5pem6zd5dlrhpdycbpmixmjx6metcwj/oifeh0xbn8jhgn4bcb57knik5ojnmx5b03qimnbwmvkfxi5p0g8asi8tvbmox1s7i1kuw7n+qux/gmc3g4ivilp5jyj+xoitk/pry/yok78yoxeapxnocxz3bkd24d38ybp0dsnxq2c2yl5vg/vuqmlejwc7timbbfwgjqusbyp4smjb9ikl1xrztoarqmpu/l9x05rzjgyegpw0vsnif55aonnwfukp0lty5/yarck0xre+ylf7b9w8riz2daxa/hmr6+cvi2tdlineyq11l+1auonq7rcsdbbadtpevegfrkdlof5hqdc5byopkfcjgecqhlprgj1blfrjdonj6ctzmcsw5rshndci20otoasnu+jxifmbflkmvswaxgjqgby7/netczqxhcagpvbxnnv0fm4qrz7kxurqbjhycnliw6vgkek8+abikdek7xz6brfucxrgweqzuaaiclllon1q4x1ygyqeaeqherk54htilzhi0twac1meca1lhhbuhiiqqjz9pg5aw2uololqdes+fdswmxxqpitqgrtiryxkkx77al4k5ov8ximxjwpvuktoofpze7l2ab6t2uk2lxlvom0d62fyh7mc/anjbsf5iqw891no3hnacqfbdcrjzoztx4+ts8xjcgrjb09e65i6ixzbcrmlscfff/6jk4ulavpyjoclshgbwgt4y6euif9ykosw1sjbugtmixuyhupvyaprz8+cfonetd+qh8mri+d7j5aw3ea3slv6oe4txe9/ijc/3ef32lv48fonxup8aami89h0tyl8aaaaasuvork5cyii=
data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wbdaaudbaqeawuebaqfbqugbwwibwchbw8lcwkmeq8seheperetfhwxexqafrergceygh0dhx8fexcijciejbwehx7/2wbdaqufbqcgbw4ica4efbeuhh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh4ehh7/waarcabjaekdasiaahebaxeb/8qahaaaagidaqeaaaaaaaaaaaaabgcebqidcaea/8qaqraaaqmdagigbaoibwaaaaaaaqidbaafeqyhejehe0fryyeuingrfti2cnosoblr4qgwizq1ulsxf0j0oshw8f/eabkbaambaqeaaaaaaaaaaaaaaaidbaubap/eaceraaidaaicagmaaaaaaaaaaaabagmreieemrnbfciy/9oadambaairaxeapwbklnyfib7tw8pb7kwkallmim5yowwvsohhg2duse7fck2apslejgstnmljo/tqzltyl1qzm1xvwbwgx2jp+y+vrb3axrehtakkkickkct8y91hfpnji5ktta9fc44orysvhxnyiffac4kluhq5yjryy7grx8jxnh2r7qfkerb8mdc+ym9csyrwg6gcr0evmlk9gdwjfzneils0cfx55whsk8a+6li4hxrcikp3wd4g0wngxkzwbefuc8geqe1q/euuuc7qcja8zanwmck5edkj3q3p21v+d4v9m39uvlarlhgpfs9y/iicrkhete3jtgckdhqssmdflukitbww0r5prx4jogjtlzxjustskdyetkjjgruftq811o5uyqqr1susgkjsbufgpfrhcynu0i5lul6gegqsj4jgq4qbskju6q0/dnqxennlc7qvdcew0qtbzo0wh8atoc71desy5fdjphacya5c6+hw5kg04pikurzsorpzxfr9klppznvuldwcklwab3acsuk3gwa3r1nnonpwczjffybxqh48yvwltvltsml1zqwedcy7o+qbsvh8prqjipwghffgv9w2/cfu2tkk9wrbbzmhpsuipgvsjehxchcsoygcngovork3fpkhkrube0nadfpovfivshu1uty65r8efjxn61qp5h/qj8awdryfj3qx001icuqurwevys251lagcfq4tgyo3fuijhfvhpzx1jultdbtxkelsaz55igptrrdra5lq1sfhvb0wllecyfgqmdchsegqova7yydt44orlwuunskeudctwqis620wyntycdy510lc0+wqi4yhao6gtngakcr2ljbg/bjbobnhc7mus57wc7bdqsve3y0kl12aso319cb1biunq0qw6hclmsup2chsatgkjhppzzipdkssydanxv+2ad4alwkk+ox2fpj9ivhhuyq4laqlpisab2af+udaatztwtzjqeb6oeggoyt5giuwkl9crqzseal30btcdbiekbwchxoakzo23vqrohr8s4ltsiqpkuioiwgeeju3zzow1jbtb3zhquhjhrygaruvo+bamd3jbcunxsgfp2uuzays6ri1p630zajiydhq7qftkfjxv8ahnn/kt3/ahyphw8ck0tpcjsvc+qqb1o7v93505jembg50c6wkrlqyl0teuogfljrxkfnuiayb4j3vhh6enoqx2votthzwdkmqeakazkyapmbb00npji30ygk+ucea7eusuntpozlpbclbbioewrt3flvbxn/tfnd4osscskcurgzstrucnjg9b8goh6qq6lds6sqy2ghi8ykbgrbkljpt2uejrukutqha2dipiaglv8abzcaei7cvrs2fvw2kdoowe/as+2otn7wlxogb2kxpvueu4puw3bc6milpwqaiiaocutde3h21s3oikq26rjqo8qyfsflmavjznsm+i4j6tik/aqmmlncjbe9d8lsnva5axy91cxynuxgsaelzfpjflopkgcan7kiujscvqg1utk5gdwrjjz2mhlqk7owpcscp1wcscad++dgevppsmlxatuzstjibtngo4d21opr3tmz5n2vclcggua+jqzwke52axnfs/g5h9o99x86v2ikw8ysrit/uebqnchq5kudetppxxuraib5eut6rkgtzkpx8zolb8mghefxjpt/4ok0l+6y/pj/ahpsl+rflnlqdz7iwsqobxji2ibt+dits1/zm2ikl+u/f4mhxziukkzptxnzp/yv3w4/np3k5s6pp4zqt/vofenr2rcndww1pd1ndlk405isw0p/jsghc58bsgv8l9lzupitlkhdlepidvi7abtc1b8pnpol3evlsr6eueyopnnsooia2pkutujeordxxokiciryhf1sdnjhi11cucltaaaobjvzjaucnhfkgj9efvjrqgr8zz56v71td0zlv9mhniousaofhwpoq7j7qslc68o2l9h/2q==

Zdjęcia bez atrybutu ALT

https://vwo.com/blog/wp-content/uploads/2014/04/xpricecharting-logo.gif.pagespeed.ic.nik3hfafou.png
https://vwo.com/blog/wp-content/uploads/2015/03/xvvaa-false-button.jpg.pagespeed.ic.fmux2bnjuw.jpg
https://vwo.com/blog/wp-content/uploads/2014/08/xmeddelandelan_logo.png.pagespeed.ic.w9ac6fxwmu.png
//go.pardot.com/l/159891/2016-09-23/9l4mm/159891/16484/ebook_icon.png
//go.pardot.com/l/159891/2016-06-30/2ndcp/159891/10606/icon.png
//go.pardot.com/l/159891/2016-06-29/2n2w9/159891/10472/shopclues_logo_2.png
//go.pardot.com/l/159891/2016-06-29/2n2vw/159891/10460/vwo_inflow_ebook.png
//go.pardot.com/l/159891/2016-06-29/2n2vw/159891/10460/vwo_inflow_ebook.png
//go.pardot.com/l/159891/2016-06-29/2n2vr/159891/10458/getresponse.png
https://vwo.com/blog/wp-content/uploads/2014/04/xpricecharting-logo.gif.pagespeed.ic.nik3hfafou.png
https://vwo.com/blog/wp-content/uploads/2015/03/xvvaa-false-button.jpg.pagespeed.ic.fmux2bnjuw.jpg
https://vwo.com/blog/wp-content/uploads/2014/08/xmeddelandelan_logo.png.pagespeed.ic.w9ac6fxwmu.png
//go.pardot.com/l/159891/2016-09-23/9l4mm/159891/16484/ebook_icon.png
//go.pardot.com/l/159891/2016-06-30/2ndcp/159891/10606/icon.png
//go.pardot.com/l/159891/2016-06-29/2n2w9/159891/10472/shopclues_logo_2.png
//go.pardot.com/l/159891/2016-06-29/2n2vw/159891/10460/vwo_inflow_ebook.png
//go.pardot.com/l/159891/2016-06-29/2n2vw/159891/10460/vwo_inflow_ebook.png
//go.pardot.com/l/159891/2016-06-29/2n2vr/159891/10458/getresponse.png
/images/page_home/map/xmap-new.jpg.pagespeed.ic.3d4wt1odw5.jpg
/images/testimonials/scott_swanson.jpg.pagespeed.ce.tfog9refsk.jpg
/images/testimonials/xroger_elliot.jpg.pagespeed.ic.qckqxrfgjw.jpg
/images/testimonials/xsunit_singh.jpg.pagespeed.ic.rg9jd9mflx.jpg
/xresample.php,qq=https,3a,_,_vwo.com,_blog,_wp-content,_uploads,_2016,_11,_ibm.png.pagespeed.ic.dz--nwodoi.jpg
https://vwo.com/blog/wp-content/uploads/2016/11/blog-cta.png.pagespeed.ce.zqns-mjtca.png
/xresample.php,qq=https,3a,_,_vwo.com,_blog,_wp-content,_uploads,_2016,_10,_a.jpg.pagespeed.ic.t43ltwrlyu.jpg

Ranking:


Alexa Traffic
Daily Global Rank Trend
Daily Reach (Percent)









Majestic SEO











Text on page:

please click here if you are not redirected within a few seconds. vwo call sales free trial login menu features pricing blog resources request demo free trial login features pricing blog visual website optimizer resources case studies making cta more relevant increased conversions by... november 22nd, 2013 removing a line from header image effected 7.8%... march 26th, 2015 killer headline beats image slider: an estimated win... august 21st, 2014 view all ebooks key pillars of a successful conversion optimization program september 23rd, 2016 vwo ecommerce cart abandonment report 2016 may 23rd, 2016 how an ecommerce major achieved 26% more visits-to-order... april 27th, 2016 view all webinars vwo and talia wolf webinar | convert mobile visitors... april 28th, 2016 vwo and spfu webinar | running smarter retargeting... february 22nd, 2016 vwo and getresponse | cro webinar january 7th, 2016 view all a/b testing duration calculator a/b testing significance calculator ideafox landing page analyzer request demo login a/b testing software for marketers use vwo to tweak, optimize & personalize your website with minimal it help. plans start at $49/month sign up for a free account no credit card required watch how easy it is to a/b test your website play case studies making cta more relevant increased conversions by... november 22nd, 2013 removing a line from header image effected 7.8%... march 26th, 2015 killer headline beats image slider: an estimated win... august 21st, 2014 view all ebooks key pillars of a successful conversion optimization program september 23rd, 2016 vwo ecommerce cart abandonment report 2016 may 23rd, 2016 how an ecommerce major achieved 26% more visits-to-order... april 27th, 2016 view all webinars vwo and talia wolf webinar | convert mobile visitors... april 28th, 2016 vwo and spfu webinar | running smarter retargeting... february 22nd, 2016 vwo and getresponse | cro webinar january 7th, 2016 view all a/b testing duration calculator a/b testing significance calculator ideafox landing page analyzer talk to a sales representative +1 844-822-8378 or write to us name * work email * the email you entered is incorrect. phone number the phone number you entered is incorrect. nature of enquiry * select your enquiry sales enquiry technical support other message you can also email us at sales@wingify.com vwo features pricing blog resources request demo free trial login how it works modified page original page $0k sales 0% conversion rate $0k sales 0% conversion rate create and a/b test different versions of your website to continuously discover the best performing versions that increase your online sales. tools included testing & experimentation a/b testing split url testing multivariate testing research & user feedback idea factory real feedback by users landing page analyzer analytics & reporting heatmaps revenue analysis segmentable reports targeting & personalization deploy personalized content target specific visitor types measure visitor segment metrics view all features what is visual website optimizer? it's an easy to use a/b testing tool that allows marketing professionals to create different versions of their websites and landing pages using a point-and-click editor (no html knowledge needed!) and then see which version produces maximum conversion rate or sales. integrating our split testing software is dead-simple: copy-paste a code snippet in your website once and you are ready to go live! visual website optimizer is also a flexible multivariate testing software (full factorial methodology) and has number of additional tools like behavioral targeting, heatmaps, usability testing, etc. with 100+ features in visual website optimizer, you can be sure that all your conversion rate optimization activities are covered by our product. thousands of enterprises and small businesses are using our a/b testing software for landing page optimization, increasing website sales and improving conversion rates (see all case studies). signup for a free 30 day trial today. trusted by thousands of leading brands the proof is in the numbers 62% increase in inquiries multivariate testing hyundai korean car maker increased test drive requests for test drives details » 158% increase in trial signups a/b testing get response the leader in email marketing a/b tested call to action buttons details » 41% increase in sales a/b testing smiley cookie the us based ecommerce store tested the next shipping v/s other offers details » 25% increase in registrations heatmap pair the popular app for couples ran heatmaps on their landing page details » vwo's thoughtful user interface and large library of success stories enable constant site testing, even by non-technical people. scott swanson consultant to microsoft we're smitten with vwo for a couple reasons - it's pretty simple to set up, and reading the results is a breeze. checking test results is our new favorite addiction. roger elliot ceo at uncommon knowledge we redesigned our entire website and vwo helped us set a/b tests to gauge the performance of the new site. we used it extensively. sunit singh chief designer at cleartrip as seen on 50ms average response time 1.5bn+ visitors served 300,000 campaigns created 99.99% uptime of servers 4000 customers and counting from the blog a 4-fold approach to increasing conversion rate on your website posted in conversion optimization on november 29th, 2016 why we are evolving into a conversion optimization platform posted in conversion optimization on november 15th, 2016 running an a/a test before a/b testing – wise or waste? posted in a/b split testing on october 31st, 2016 product features pricing faqs knowledgebase on-page surveys visitor behavior analysis smartstats integrations compare vwo free trial free trial free trial resources blog case studies guides & ebooks videos & webinars a/b testing guide split testing with vwo free tools vwo for marketers what is multivariate testing conversion rate optimization company about us careers partners team blog engineering blog contact us copyright © wingify. vwo is made by wingify. terms of use privacy policy opt out english 日本語 visual website optimizer email address the email address you entered is incorrect. password the password you entered is incorrect. remember me forgot password? not a registered user? sign up sign up for a free trial no credit card required work email * the email address you entered is incorrect. password * the password you entered is incorrect. full name * phone number * the phone number you entered is incorrect. are you an agency or consultant? yes no what is your average monthly traffic? * up to 50k visitors/mo up to 100k visitors/mo up to 500k visitors/mo up to 1 million visitors/mo more than 1 million visitors/mo not sure by signing up you agree to our terms and privacy policy what's included all features in standard plans 1,000 visitor limit unlimited email tech support valid for 30 days from signup upgrade your trial account directly to a paid account after your trial expires. no campaign data will be lost during the upgrade. vwo does [a/b testing] so disruptively, embarrassingly better than google does that it puts a smile on my face. patrick mckenzie check your email! we've sent a message to yourmail@domain.com with an activation link in it. just click the link, and we'll take it from there. can't find the mail? check your spam, junk or secondary inboxes. still can't find it? let us know at support@vwo.com


Here you find all texts from your page as Google (googlebot) and others search engines seen it.

Words density analysis:

Numbers of all words: 1183

One word

Two words phrases

Three words phrases

test - 2.79% (33)
and - 2.7% (32)
you - 2.28% (27)
the - 2.28% (27)
our - 2.03% (24)
testing - 2.03% (24)
vwo - 1.69% (20)
a/b - 1.52% (18)
version - 1.52% (18)
2016 - 1.44% (17)
for - 1.27% (15)
opt - 1.27% (15)
site - 1.27% (15)
your - 1.18% (14)
all - 1.18% (14)
conversion - 1.18% (14)
website - 1.1% (13)
visitor - 1.01% (12)
are - 1.01% (12)
sign - 0.93% (11)
trial - 0.93% (11)
free - 0.85% (10)
sales - 0.85% (10)
email - 0.85% (10)
page - 0.76% (9)
webinar - 0.76% (9)
increase - 0.68% (8)
get - 0.68% (8)
use - 0.68% (8)
optimization - 0.68% (8)
visitors - 0.68% (8)
view - 0.59% (7)
blog - 0.59% (7)
features - 0.59% (7)
entered - 0.59% (7)
incorrect. - 0.59% (7)
rate - 0.59% (7)
optimize - 0.51% (6)
number - 0.51% (6)
landing - 0.51% (6)
with - 0.51% (6)
can - 0.51% (6)
car - 0.51% (6)
target - 0.42% (5)
visitors/mo - 0.42% (5)
password - 0.42% (5)
ecommerce - 0.42% (5)
visual - 0.42% (5)
optimizer - 0.42% (5)
more - 0.42% (5)
from - 0.42% (5)
versions - 0.42% (5)
line - 0.42% (5)
calculator - 0.34% (4)
7th, - 0.34% (4)
that - 0.34% (4)
split - 0.34% (4)
heatmap - 0.34% (4)
response - 0.34% (4)
targeting - 0.34% (4)
user - 0.34% (4)
details - 0.34% (4)
multivariate - 0.34% (4)
software - 0.34% (4)
phone - 0.34% (4)
tool - 0.34% (4)
what - 0.34% (4)
april - 0.34% (4)
know - 0.34% (4)
23rd, - 0.34% (4)
case - 0.34% (4)
image - 0.34% (4)
pricing - 0.34% (4)
request - 0.34% (4)
report - 0.34% (4)
studies - 0.34% (4)
login - 0.34% (4)
november - 0.34% (4)
how - 0.34% (4)
22nd, - 0.34% (4)
resources - 0.34% (4)
signup - 0.25% (3)
sure - 0.25% (3)
create - 0.25% (3)
wingify. - 0.25% (3)
analyzer - 0.25% (3)
demo - 0.25% (3)
posted - 0.25% (3)
day - 0.25% (3)
support - 0.25% (3)
account - 0.25% (3)
success - 0.25% (3)
enquiry - 0.25% (3)
ebooks - 0.25% (3)
click - 0.25% (3)
work - 0.25% (3)
running - 0.25% (3)
increased - 0.25% (3)
webinars - 0.25% (3)
heatmaps - 0.25% (3)
check - 0.25% (3)
idea - 0.25% (3)
knowledge - 0.25% (3)
tech - 0.25% (3)
see - 0.25% (3)
tools - 0.25% (3)
not - 0.25% (3)
cro - 0.25% (3)
address - 0.25% (3)
increasing - 0.17% (2)
testing, - 0.17% (2)
making - 0.17% (2)
drive - 0.17% (2)
using - 0.17% (2)
their - 0.17% (2)
marketing - 0.17% (2)
thousands - 0.17% (2)
relevant - 0.17% (2)
tested - 0.17% (2)
cta - 0.17% (2)
set - 0.17% (2)
app - 0.17% (2)
out - 0.17% (2)
find - 0.17% (2)
can't - 0.17% (2)
link - 0.17% (2)
sent - 0.17% (2)
smile - 0.17% (2)
does - 0.17% (2)
campaign - 0.17% (2)
upgrade - 0.17% (2)
limit - 0.17% (2)
than - 0.17% (2)
million - 0.17% (2)
full - 0.17% (2)
call - 0.17% (2)
policy - 0.17% (2)
ran - 0.17% (2)
privacy - 0.17% (2)
terms - 0.17% (2)
guide - 0.17% (2)
behavior - 0.17% (2)
product - 0.17% (2)
time - 0.17% (2)
average - 0.17% (2)
new - 0.17% (2)
results - 0.17% (2)
conversions - 0.17% (2)
simple - 0.17% (2)
couple - 0.17% (2)
consultant - 0.17% (2)
even - 0.17% (2)
it's - 0.17% (2)
major - 0.17% (2)
segment - 0.17% (2)
january - 0.17% (2)
personalize - 0.17% (2)
2014 - 0.17% (2)
marketers - 0.17% (2)
key - 0.17% (2)
pillars - 0.17% (2)
successful - 0.17% (2)
program - 0.17% (2)
ideafox - 0.17% (2)
significance - 0.17% (2)
september - 0.17% (2)
duration - 0.17% (2)
cart - 0.17% (2)
abandonment - 0.17% (2)
getresponse - 0.17% (2)
here - 0.17% (2)
february - 0.17% (2)
retargeting... - 0.17% (2)
smarter - 0.17% (2)
spfu - 0.17% (2)
28th, - 0.17% (2)
visitors... - 0.17% (2)
mobile - 0.17% (2)
convert - 0.17% (2)
wolf - 0.17% (2)
talia - 0.17% (2)
may - 0.17% (2)
27th, - 0.17% (2)
visits-to-order... - 0.17% (2)
26% - 0.17% (2)
21st, - 0.17% (2)
plans - 0.17% (2)
by... - 0.17% (2)
26th, - 0.17% (2)
analysis - 0.17% (2)
feedback - 0.17% (2)
2013 - 0.17% (2)
achieved - 0.17% (2)
header - 0.17% (2)
included - 0.17% (2)
sales. - 0.17% (2)
effected - 0.17% (2)
7.8%... - 0.17% (2)
different - 0.17% (2)
march - 0.17% (2)
$0k - 0.17% (2)
also - 0.17% (2)
message - 0.17% (2)
august - 0.17% (2)
other - 0.17% (2)
technical - 0.17% (2)
2015 - 0.17% (2)
killer - 0.17% (2)
headline - 0.17% (2)
beats - 0.17% (2)
slider: - 0.17% (2)
estimated - 0.17% (2)
name - 0.17% (2)
win... - 0.17% (2)
easy - 0.17% (2)
required - 0.17% (2)
card - 0.17% (2)
credit - 0.17% (2)
removing - 0.17% (2)
a/b testing - 1.1% (13)
is incorrect. - 0.59% (7)
conversion rate - 0.59% (7)
entered is - 0.59% (7)
view all - 0.59% (7)
free trial - 0.59% (7)
you entered - 0.59% (7)
2016 vwo - 0.51% (6)
vwo and - 0.51% (6)
landing page - 0.51% (6)
website optimizer - 0.42% (5)
conversion optimization - 0.42% (5)
your website - 0.42% (5)
visual website - 0.42% (5)
23rd, 2016 - 0.34% (4)
webinar | - 0.34% (4)
increase in - 0.34% (4)
details » - 0.34% (4)
case studies - 0.34% (4)
multivariate testing - 0.34% (4)
2016 view - 0.34% (4)
testing software - 0.34% (4)
features pricing - 0.34% (4)
phone number - 0.34% (4)
7th, 2016 - 0.34% (4)
request demo - 0.25% (3)
what is - 0.25% (3)
pricing blog - 0.25% (3)
split testing - 0.25% (3)
sign up - 0.25% (3)
up for - 0.25% (3)
trial login - 0.25% (3)
the email - 0.25% (3)
a free - 0.25% (3)
email address - 0.25% (3)
posted in - 0.25% (3)
page analyzer - 0.25% (3)
calculator ideafox - 0.17% (2)
testing significance - 0.17% (2)
you are - 0.17% (2)
calculator a/b - 0.17% (2)
| convert - 0.17% (2)
major achieved - 0.17% (2)
26% more - 0.17% (2)
visits-to-order... april - 0.17% (2)
27th, 2016 - 0.17% (2)
webinars vwo - 0.17% (2)
and talia - 0.17% (2)
wolf webinar - 0.17% (2)
mobile visitors... - 0.17% (2)
testing duration - 0.17% (2)
april 28th, - 0.17% (2)
and spfu - 0.17% (2)
running smarter - 0.17% (2)
retargeting... february - 0.17% (2)
22nd, 2016 - 0.17% (2)
getresponse | - 0.17% (2)
january 7th, - 0.17% (2)
all a/b - 0.17% (2)
cro webinar - 0.17% (2)
0% conversion - 0.17% (2)
name * - 0.17% (2)
on november - 0.17% (2)
your trial - 0.17% (2)
million visitors/mo - 0.17% (2)
1 million - 0.17% (2)
number you - 0.17% (2)
the phone - 0.17% (2)
card required - 0.17% (2)
no credit - 0.17% (2)
the password - 0.17% (2)
incorrect. password - 0.17% (2)
address you - 0.17% (2)
vwo free - 0.17% (2)
in a/b - 0.17% (2)
optimization on - 0.17% (2)
work email - 0.17% (2)
in conversion - 0.17% (2)
from the - 0.17% (2)
vwo for - 0.17% (2)
thousands of - 0.17% (2)
30 day - 0.17% (2)
software for - 0.17% (2)
features in - 0.17% (2)
all features - 0.17% (2)
versions of - 0.17% (2)
2016 how - 0.17% (2)
$0k sales - 0.17% (2)
sales 0% - 0.17% (2)
an ecommerce - 0.17% (2)
win... august - 0.17% (2)
may 23rd, - 0.17% (2)
ecommerce cart - 0.17% (2)
2014 view - 0.17% (2)
all ebooks - 0.17% (2)
key pillars - 0.17% (2)
successful conversion - 0.17% (2)
optimization program - 0.17% (2)
september 23rd, - 0.17% (2)
abandonment report - 0.17% (2)
estimated win... - 0.17% (2)
2016 may - 0.17% (2)
how an - 0.17% (2)
ecommerce major - 0.17% (2)
achieved 26% - 0.17% (2)
more visits-to-order... - 0.17% (2)
april 27th, - 0.17% (2)
august 21st, - 0.17% (2)
slider: an - 0.17% (2)
talia wolf - 0.17% (2)
november 22nd, - 0.17% (2)
resources request - 0.17% (2)
demo free - 0.17% (2)
studies making - 0.17% (2)
cta more - 0.17% (2)
relevant increased - 0.17% (2)
conversions by... - 0.17% (2)
2013 removing - 0.17% (2)
beats image - 0.17% (2)
a line - 0.17% (2)
from header - 0.17% (2)
image effected - 0.17% (2)
7.8%... march - 0.17% (2)
26th, 2015 - 0.17% (2)
killer headline - 0.17% (2)
all webinars - 0.17% (2)
convert mobile - 0.17% (2)
report 2016 - 0.17% (2)
an estimated - 0.17% (2)
header image - 0.17% (2)
effected 7.8%... - 0.17% (2)
march 26th, - 0.17% (2)
2015 killer - 0.17% (2)
headline beats - 0.17% (2)
image slider: - 0.17% (2)
21st, 2014 - 0.17% (2)
removing a - 0.17% (2)
ebooks key - 0.17% (2)
pillars of - 0.17% (2)
a successful - 0.17% (2)
program september - 0.17% (2)
vwo ecommerce - 0.17% (2)
cart abandonment - 0.17% (2)
line from - 0.17% (2)
22nd, 2013 - 0.17% (2)
visitors... april - 0.17% (2)
webinar january - 0.17% (2)
28th, 2016 - 0.17% (2)
spfu webinar - 0.17% (2)
| running - 0.17% (2)
smarter retargeting... - 0.17% (2)
february 22nd, - 0.17% (2)
and getresponse - 0.17% (2)
duration calculator - 0.17% (2)
by... november - 0.17% (2)
significance calculator - 0.17% (2)
ideafox landing - 0.17% (2)
for marketers - 0.17% (2)
credit card - 0.17% (2)
making cta - 0.17% (2)
more relevant - 0.17% (2)
increased conversions - 0.17% (2)
check your - 0.17% (2)
you entered is - 0.59% (7)
2016 view all - 0.34% (4)
2016 vwo and - 0.34% (4)
for a free - 0.25% (3)
landing page analyzer - 0.25% (3)
free trial login - 0.25% (3)
visitors/mo up to - 0.25% (3)
ebooks key pillars - 0.17% (2)
more visits-to-order... april - 0.17% (2)
mobile visitors... april - 0.17% (2)
webinar | convert - 0.17% (2)
and talia wolf - 0.17% (2)
all webinars vwo - 0.17% (2)
27th, 2016 view - 0.17% (2)
slider: an estimated - 0.17% (2)
win... august 21st, - 0.17% (2)
of a successful - 0.17% (2)
major achieved 26% - 0.17% (2)
how an ecommerce - 0.17% (2)
28th, 2016 vwo - 0.17% (2)
abandonment report 2016 - 0.17% (2)
2014 view all - 0.17% (2)
vwo ecommerce cart - 0.17% (2)
september 23rd, 2016 - 0.17% (2)
conversion optimization program - 0.17% (2)
may 23rd, 2016 - 0.17% (2)
retargeting... february 22nd, - 0.17% (2)
and spfu webinar - 0.17% (2)
different versions of - 0.17% (2)
number you entered - 0.17% (2)
is incorrect. password - 0.17% (2)
address you entered - 0.17% (2)
password you entered - 0.17% (2)
the email address - 0.17% (2)
conversion rate optimization - 0.17% (2)
conversion optimization on - 0.17% (2)
in conversion optimization - 0.17% (2)
0% conversion rate - 0.17% (2)
| running smarter - 0.17% (2)
sales 0% conversion - 0.17% (2)
the phone number - 0.17% (2)
* the email - 0.17% (2)
significance calculator ideafox - 0.17% (2)
calculator a/b testing - 0.17% (2)
a/b testing duration - 0.17% (2)
webinar january 7th, - 0.17% (2)
getresponse | cro - 0.17% (2)
26th, 2015 killer - 0.17% (2)
headline beats image - 0.17% (2)
from header image - 0.17% (2)
effected 7.8%... march - 0.17% (2)
an estimated win... - 0.17% (2)
23rd, 2016 how - 0.17% (2)
report 2016 may - 0.17% (2)
ecommerce cart abandonment - 0.17% (2)
23rd, 2016 vwo - 0.17% (2)
optimization program september - 0.17% (2)
a successful conversion - 0.17% (2)
key pillars of - 0.17% (2)
view all ebooks - 0.17% (2)
august 21st, 2014 - 0.17% (2)
beats image slider: - 0.17% (2)
achieved 26% more - 0.17% (2)
2015 killer headline - 0.17% (2)
7.8%... march 26th, - 0.17% (2)
header image effected - 0.17% (2)
a line from - 0.17% (2)
22nd, 2013 removing - 0.17% (2)
conversions by... november - 0.17% (2)
more relevant increased - 0.17% (2)
studies making cta - 0.17% (2)
demo free trial - 0.17% (2)
an ecommerce major - 0.17% (2)
visits-to-order... april 27th, - 0.17% (2)
blog resources request - 0.17% (2)
a/b testing significance - 0.17% (2)
removing a line - 0.17% (2)
november 22nd, 2013 - 0.17% (2)
increased conversions by... - 0.17% (2)
cta more relevant - 0.17% (2)
case studies making - 0.17% (2)
no credit card - 0.17% (2)
sign up for - 0.17% (2)
testing software for - 0.17% (2)
calculator ideafox landing - 0.17% (2)
testing duration calculator - 0.17% (2)
webinars vwo and - 0.17% (2)
view all a/b - 0.17% (2)
january 7th, 2016 - 0.17% (2)
| cro webinar - 0.17% (2)
vwo and getresponse - 0.17% (2)
february 22nd, 2016 - 0.17% (2)
running smarter retargeting... - 0.17% (2)
spfu webinar | - 0.17% (2)
visitors... april 28th, - 0.17% (2)
| convert mobile - 0.17% (2)
talia wolf webinar - 0.17% (2)
1 million visitors/mo - 0.17% (2)

Here you can find chart of all your popular one, two and three word phrases. Google and others search engines means your page is about words you use frequently.

Copyright © 2015-2016 hupso.pl. All rights reserved. FB | +G | Twitter

Hupso.pl jest serwisem internetowym, w którym jednym kliknieciem możesz szybko i łatwo sprawdź stronę www pod kątem SEO. Oferujemy darmowe pozycjonowanie stron internetowych oraz wycena domen i stron internetowych. Prowadzimy ranking polskich stron internetowych oraz ranking stron alexa.