1.00 score from hupso.pl for:
uitvconnect.com



HTML Content


Title today's top news headlines, global, business, entertainment, sports & video news | uitv

Length: 94, Words: 11
Description today's breaking news headlines, latest top world news includes business, sports, weather, politics, entertainment and social media news, videos & updates.

Length: 164, Words: 22
Keywords top news headlines, breaking world news, entertainment news, internet television news, world current affairs, social media videos, latest international news
Robots
Charset UTF-8
Og Meta - Title exist
Og Meta - Description pusty
Og Meta - Site name exist
Tytuł powinien zawierać pomiędzy 10 a 70 znaków (ze spacjami), a mniej niż 12 słów w długości.
Meta opis powinien zawierać pomiędzy 50 a 160 znaków (łącznie ze spacjami), a mniej niż 24 słów w długości.
Kodowanie znaków powinny być określone , UTF-8 jest chyba najlepszy zestaw znaków, aby przejść z powodu UTF-8 jest bardziej międzynarodowy kodowaniem.
Otwarte obiekty wykresu powinny być obecne w stronie internetowej (więcej informacji na temat protokołu OpenGraph: http://ogp.me/)

SEO Content

Words/Characters 1092
Text/HTML 6.94 %
Headings H1 2
H2 9
H3 0
H4 4
H5 0
H6 1
H1
welcome to uitv
H2
search form
quick registration
categories
uitv business products lalor ltd colored pillar candles

r.m.foods roasted balnched peanuts

derewala industries limited. pendants

lanoveldens h4 container

gustopiu di santoro afvs300

payam baharat dry mint

inteclighting future min

kao chen cervical c

arabian auto agency constructi

shankar’s emporium digital slr camera

edible oils edible oils

cmt cmt

view more
uitv business products
quick registration
uitv b2c products wybor 40-mi-15n06 102 cm (40... electronics jealous 21 womens dark blue... womens clothing women's black & pin... womens clothing fungus knit wear t-shirt - b... mens clothing g.a.s tapto cricket bat sports & shoes adidas eyota m navy sport sh... sports & shoes queen size sofa cum bed home & furniture l shaped sofa set in beige home & furniture sound king sk8500 karaoke 4c... electronics roly girls dark pink with se... baby & kids roly girls polo half sleeve... baby & kids basics life men's red c... mens clothing view more
uitv b2c products
uitv video - entertainment
H3
H4 showbiz & entertainment
music
lifestyle
sports
H5
H6 around uitv connect channels today
strong
las vegas,
edible oils
moscow,
seoul,
washington,
united nations
ankara
damascus
 los angeles
los angeles,
los angeles
new delhi,
los angeles,
makanyi lodge...
itc grand bharat
the mulia
hamanasi
royal malewane
demi lovato's private photos leaked, actress says 'it's just cleavage'
virat kohli has become the donald trump of world sport: australian media
kate hudson sparks dating rumours with musician
david warner hopes glenn maxwell can continue playing test cricket for long time
actor george clooney surprises fan on her 87th birthday
cheteshwar pujara gains no.2 slot of top icc test batsman
tom cruise spent a year training for a sequence in 'mission: impossible 6'
casemiro believes striker luis suarez's absence in uruguay team will help brazil
mel b files for divorce from stephen belafonte
goalkeeper manuel neuer out of germany's world cup qualifier
b
las vegas,
edible oils
moscow,
seoul,
washington,
united nations
ankara
damascus
 los angeles
los angeles,
los angeles
new delhi,
los angeles,
makanyi lodge...
itc grand bharat
the mulia
hamanasi
royal malewane
demi lovato's private photos leaked, actress says 'it's just cleavage'
virat kohli has become the donald trump of world sport: australian media
kate hudson sparks dating rumours with musician
david warner hopes glenn maxwell can continue playing test cricket for long time
actor george clooney surprises fan on her 87th birthday
cheteshwar pujara gains no.2 slot of top icc test batsman
tom cruise spent a year training for a sequence in 'mission: impossible 6'
casemiro believes striker luis suarez's absence in uruguay team will help brazil
mel b files for divorce from stephen belafonte
goalkeeper manuel neuer out of germany's world cup qualifier
i
em
Bolds strong 28
b 28
i 0
em 0
Zawartość strony internetowej powinno zawierać więcej niż 250 słów, z stopa tekst / kod jest wyższy niż 20%.
Pozycji używać znaczników (h1, h2, h3, ...), aby określić temat sekcji lub ustępów na stronie, ale zwykle, użyj mniej niż 6 dla każdego tagu pozycje zachować swoją stronę zwięzły.
Styl używać silnych i kursywy znaczniki podkreślić swoje słowa kluczowe swojej stronie, ale nie nadużywać (mniej niż 16 silnych tagi i 16 znaczników kursywy)

Statystyki strony

twitter:title exist
twitter:description pusty
google+ itemprop=name pusty
Pliki zewnętrzne 33
Pliki CSS 6
Pliki javascript 27
Plik należy zmniejszyć całkowite odwołanie plików (CSS + JavaScript) do 7-8 maksymalnie.

Linki wewnętrzne i zewnętrzne

Linki 243
Linki wewnętrzne 167
Linki zewnętrzne 76
Linki bez atrybutu Title 214
Linki z atrybutem NOFOLLOW 0
Linki - Użyj atrybutu tytuł dla każdego łącza. Nofollow link jest link, który nie pozwala wyszukiwarkom boty zrealizują są odnośniki no follow. Należy zwracać uwagę na ich użytkowania

Linki wewnętrzne

#
- /
uitv business /business
uitv travel /travel
uitv pio/nri/youth diaspora‏ /pio-nri-diaspora
news paper /newspaper
news /content/news
latest news /content/news/latest-news
asia news /content/news/asia-news
world news /content/news/world-news
movies /content/movies
bollywood /content/movies/bollywood
hollywood /content/movies/hollywood
bollywood gossip /content/movies/bollywood-gossip
regional indian movies /content/movies/regional-indian/
music /content/music
bollywood music /content/music/indian
international music /content/music/world-music
regional indian music /content/music/regional-indian-music/
sports /content/sport
cricket /content/sport/cricket
football /content/sport/football
other sports /content/sport/other-sports
entertainment /content/entertainment
showbiz /content/entertainment/showbiz
interviews /content/entertainment/interviews
legend /uitvlegends
- /newspaper/us-stocks-tumble-trump-policy-uncertain
/newspaper/us-stocks-tumble-trump-policy-uncertain
- #
- /newspaper/we-are-creating-magic-clouds-adobe
we are creating magic in clouds: adobe /newspaper/we-are-creating-magic-clouds-adobe
- #
- /newspaper/tokyo-shares-tumble-over-trump-policy-pyongyang-missile-launch
tokyo shares tumble over trump policy, /newspaper/tokyo-shares-tumble-over-trump-policy-pyongyang-missile-launch
- /landing-listing
manufactures & fabricators /business-categories/98615
agriculture /business-categories/30119
apparel /business-categories/30118
automobiles & motorcycles /business-categories/30117
beauty & personal care /business-categories/30116
chemicals /business-categories/30115
computer hardware & software /business-categories/30114
consumer electronics /business-categories/30112
electrical equipment & supplies /business-categories/30111
energy /business-categories/30110
fashion accessories /business-categories/30109
food & beverage /business-categories/30108
furniture /business-categories/30107
light & lighting /business-categories/30103
machinery /business-categories/30102
minerals & metallurgy /business-categories/30100
shoes & accessories /business-categories/30097
sports accessories /business-categories/30096
textiles & leather products /business-categories/30095
transportation /business-categories/30093
property /business-categories/30091
import & export /business-categories/30090
wedding accessories /business-categories/30088
jewellery /business-categories/30087
financial institutions /business-categories/30085
view more business
world /newspaper/category/world-newspaper
indian /newspaper/category/indian-newspaper
asian /newspaper/category/asian-newspaper
business /newspaper/category/business-newspaper
technology /newspaper/category/science-technology-newspaper
education /newspaper/category/education-universities-newspaper
diaspora /pio-nri-diaspora
more... /newspaper
- /newspaper/two-shot-outside-british-parliament
two shot outside british parliament
/newspaper/two-shot-outside-british-parliament
- /newspaper/us-president-donald-trump-signs-bill-pushing-crewed-nasa-mission-mars
us president donald trump signs bill pushing for crewed nasa mission to mars
/newspaper/us-president-donald-trump-signs-bill-pushing-crewed-nasa-mission-mars
- /newspaper/uk-bans-laptops-and-tablets-flights-six-middle-east-countries
uk bans laptops and tablets on flights from six middle east countries
/newspaper/uk-bans-laptops-and-tablets-flights-six-middle-east-countries
- /newspaper/us-intelligence-committee-%e2%80%98confused-kremlin-spokesman-dmitry-peskov
us intelligence committee is ‘confused': kremlin spokes /newspaper/us-intelligence-committee-%e2%80%98confused-kremlin-spokesman-dmitry-peskov
- /newspaper/seoul-confirms-pyongyang-missile-test-failure
seoul confirms pyongyang missile test failure /newspaper/seoul-confirms-pyongyang-missile-test-failure
- /newspaper/us-president-donald-trump-attend-nato-summit-may
us president donald trump to attend nato summit in may /newspaper/us-president-donald-trump-attend-nato-summit-may
- /newspaper/un-secretary-general-antonio-guterres-urges-world-stand-against-intolerance
un secretary-general antonio guterres urges world /newspaper/un-secretary-general-antonio-guterres-urges-world-stand-against-intolerance
- /newspaper/turkey-summons-german-charge-daffaires-over-gulen-remarks
turkey summons german charge d'affaires over /newspaper/turkey-summons-german-charge-daffaires-over-gulen-remarks
- /newspaper/33-civilians-killed-syria-air-strike
33 civilians killed in syria air strike /newspaper/33-civilians-killed-syria-air-strike
movies /content/movies
music /content/music
sports /content/sport
entertainment /content/entertainment
more... /content/entertainment
mariah carey's single gets film adaptation
/newspaper/mariah-careys-single-gets-film-adaptation
- /newspaper/still-challenge-women-entertainment-industry-jennifer-lopez
still a challenge for women in entertainment industry: jennifer lopez
/newspaper/still-challenge-women-entertainment-industry-jennifer-lopez
- /newspaper/demi-lovatos-private-photos-leaked-actress-says-its-just-cleavage
demi lovato's private photos leaked, actress says 'it's just cleavage'
/newspaper/demi-lovatos-private-photos-leaked-actress-says-its-just-cleavage
- /newspaper/salman-khan-katrina-kaif-back-together-tiger-zinda-hai
salman khan, katrina kaif 'back together' in tiger zinda /newspaper/salman-khan-katrina-kaif-back-together-tiger-zinda-hai
- /newspaper/paul-walker-was-older-brother-me-scott-eastwood
paul walker was like older brother to me: scott eastwood /newspaper/paul-walker-was-older-brother-me-scott-eastwood
- /newspaper/denim-made-me-feel-embarrassed-ashamed-khloe-kardashian
denim made me feel embarrassed, ashamed: khloe kardashian /newspaper/denim-made-me-feel-embarrassed-ashamed-khloe-kardashian
- /newspaper/kate-hudson-sparks-dating-rumours-musician
kate hudson sparks dating rumours with musician /newspaper/kate-hudson-sparks-dating-rumours-musician
- /newspaper/need-block-button-haters-actor-sunny-leone
need a block button for haters: actor sunny leone /newspaper/need-block-button-haters-actor-sunny-leone
- /newspaper/jennifer-lopez-feels-her-split-marc-anthony-got-them-closer-kids
jennifer lopez feels her split from marc anthony got them closer to /newspaper/jennifer-lopez-feels-her-split-marc-anthony-got-them-closer-kids
hotels /travels/30133
airlines /travels/30132
restaurants /travels/30131
resorts & spa /travels/30130
shopping /travels/30129
historical places /travels/30128
more... /travel
bushman's kloof wilderness reserve & wellness retreat /travel/bushmans-kloof-wilderness-reserve-wellness-retreat
- /travel/makanyi-private-game-lodge
makanyi private game lodge
/travel/makanyi-private-game-lodge
- /travel/cuixmala
cuixmala
/travel/cuixmala
- /travel/unique-garden-hotel-spa
unique garden hotel & spa
/travel/unique-garden-hotel-spa
- /travel/itc-grand-bharat
itc grand bharat
/travel/itc-grand-bharat
- /travel/mulia
the mulia
/travel/mulia
- /travel/hamanasi-adventure-dive-resort
hamanasi adventure & dive resort
/travel/hamanasi-adventure-dive-resort
- /travel/cheval-blanc-randheli
cheval blanc randheli
/travel/cheval-blanc-randheli
- /travel/royal-malewane
royal malewane
/travel/royal-malewane
add new content /node/add
- /content/https%3a//www.uitvconnect.com/newspaper/demi-lovatos-private-photos-leaked-actress-says-its-just-cleavage%20
- /content/https%3a//www.uitvconnect.com/newspaper/virat-kohli-has-become-donald-trump-world-sport-australian-media
- /content/https%3a//www.uitvconnect.com/newspaper/kate-hudson-sparks-dating-rumours-musician
- /content/https%3a//www.uitvconnect.com/newspaper/david-warner-hopes-glenn-maxwell-can-continue-playing-test-cricket-long-time
- /content/https%3a//www.uitvconnect.com/newspaper/actor-george-clooney-surprises-fan-her-87th-birthday
- /content/https%3a//www.uitvconnect.com/newspaper/cheteshwar-pujara-gains-no2-slot-top-icc-test-batsman
- /content/https%3a//www.uitvconnect.com/newspaper/tom-cruise-spent-year-training-sequence-mission-impossible-6
- /content/https%3a//www.uitvconnect.com/newspaper/casemiro-believes-striker-luis-suarezs-absence-uruguay-team-will-help-brazil
- /content/https%3a//www.uitvconnect.com/newspaper/mel-b-files-divorce-stephen-belafonte
- /content/https%3a//www.uitvconnect.com/newspaper/goalkeeper-manuel-neuer-out-germanys-world-cup-qualifier
rihanna & chris brown ‘textin... /uitv-player/video/rihanna-chris-brown-%e2%80%98texting-sexting%e2%80%99
scarlett johansson at 'ghost... /uitv-player/video/scarlett-johansson-ghost-shell-red-carpet
donald trump insulted one directi... /uitv-player/video/donald-trump-insulted-one-direction
justin bieber performs in purpose... /uitv-player/video/justin-bieber-performs-purpose-world-tour-melbourne
blac chyna and tyga pair to reuni... /uitv-player/video/blac-chyna-and-tyga-pair-reunite
don diablo & marnik - chil... /uitv-player/video/don-diablo-marnik-children-miracle
tony junior feat. omaaj &... /uitv-player/video/tony-junior-feat-omaaj-melody-noel-%e2%80%93-rock-n-roll
ryan blyth x after 6 feat. lut... /uitv-player/video/ryan-blyth-x-after-6-feat-luther-soul-special
teri fizaon ki - official musi... /uitv-player/video/teri-fizaon-ki-official-music-video-mudasir-bhat-kirti-awate
pop the bottle - vishal | shek... /uitv-player/video/pop-bottle-vishal-shekhar-badshah-akasa-pulkit-nora-remo
kylie jenner pumps her butt /uitv-player/video/kylie-jenner-pumps-her-butt
katy perry disses taylor swift... /uitv-player/video/katy-perry-disses-taylor-swift-over-nick-minaj-feud
liam hemsworth reacts to miley... /uitv-player/video/liam-hemsworth-reacts-miley-cyrus-kiss-stella-maxwell
rihanna talks about her vma no... /uitv-player/video/rihanna-talks-about-her-vma-nominations-amidst-taylor-swift-nicki-minaj-feud
fans blasts kim kardashian for... /uitv-player/video/fans-blasts-kim-kardashian-interfering-taylor-swift-nicki-minaj-feud
wriddhiman saha - chesteshwar... /uitv-player/video/wriddhiman-saha-chesteshwar-pujara-partnership-best-i-have-seen-says-virat-kohli
peter handscomb and shaun mars... /uitv-player/video/peter-handscomb-and-shaun-marsh-help-australia-draw-ranchi-test
steve smith 'rubbishes... /uitv-player/video/steve-smith-rubbishes-virat-kohlis-allegations
virat kohli says, both teams h... /uitv-player/video/virat-kohli-says-both-teams-have-moved-ahead-bengaluru
anil kumble says team won... /uitv-player/video/anil-kumble-says-team-wont-limit-aggression
- #

Linki zewnętrzne

uitv link http://www.uitvconnect.com/link
uitv culture https://www.uitvconnect.com/cultures
gallery http://www.uitvconnect.com/gallery-newspaper
-
two shot outside british parliament
https://www.uitvconnect.com/newspaper/two-shot-outside-british-parliament
-
us president donald trump signs bill pushing for crewed nasa mission to mars
https://www.uitvconnect.com/newspaper/us-president-donald-trump-signs-bill-pushing-crewed-nasa-mission-mars
-
us intelligence committee is ‘confused': kremlin spokesman dmitry peskov
https://www.uitvconnect.com/newspaper/us-intelligence-committee-%e2%80%98confused-kremlin-spokesman-dmitry-peskov
-
juventus forward paulo dybala in doubt for argentina's world cup qualifiers
https://www.uitvconnect.com/newspaper/juventus-forward-paulo-dybala-doubt-argentinas-world-cup-qualifiers
-
us president donald trump to attend nato summit in may
https://www.uitvconnect.com/newspaper/us-president-donald-trump-attend-nato-summit-may
-
us secretary of state rex tillerson to skip nato meet: us state department
https://www.uitvconnect.com/newspaper/us-secretary-state-rex-tillerson-skip-nato-meet-us-state-department
-
salman khan, katrina kaif 'back together' in tiger zinda hai
https://www.uitvconnect.com/newspaper/salman-khan-katrina-kaif-back-together-tiger-zinda-hai
-
virat kohli has become the donald trump of world sport: australian media
https://www.uitvconnect.com/newspaper/virat-kohli-has-become-donald-trump-world-sport-australian-media
-
denim made me feel embarrassed, ashamed: khloe kardashian
https://www.uitvconnect.com/newspaper/denim-made-me-feel-embarrassed-ashamed-khloe-kardashian
-
fbi is investigating trump’s russia ties, james comey confirms
https://www.uitvconnect.com/newspaper/fbi-investigating-trump%e2%80%99s-russia-ties-james-comey-confirms
exclusive business offers https://www.uitvconnect.com/landing-listing
entertainment and world news https://www.uitvconnect.com/content/entertainment
free gifts and prizes every week http://www.uitvconnect.com/maicircle-prize
join our social media "maicircle" https://www.uitvconnect.com/link/signup
connect with millions of our registered users https://www.uitvconnect.com/link/signup

lalor ltd

-

colored pillar candles

https://www.uitvconnect.com/business/lalor-ltd

r.m.foods

-

roasted balnched peanuts

https://www.uitvconnect.com/business/rmfoods

derewala industries limited.

-

pendants

https://www.uitvconnect.com/business/derewala-industries-limited

lanoveldens

-

h4 container

https://www.uitvconnect.com/business/lanoveldens

gustopiu di santoro

-

afvs300

https://www.uitvconnect.com/business/gustopiu-di-santoro-l-c-snc

payam baharat

-

dry mint

https://www.uitvconnect.com/business/payam-baharat

inteclighting

-

future min

https://www.uitvconnect.com/business/ningbo-intec-lighting-co-ltd

kao chen

-

cervical c

https://www.uitvconnect.com/business/kao-chen-enterprise-1

arabian auto agency

-

constructi

https://www.uitvconnect.com/business/arabian-auto-agency

shankar’s emporium

-

digital slr camera

https://www.uitvconnect.com/business/shankar%e2%80%99s-emporium

edible oils

-

edible oils

https://www.uitvconnect.com/business/ajit-singh-om-parkash-limited

cmt

-

cmt

https://www.uitvconnect.com/business/djinn-ltd
- https://www.uitvconnect.com/b2c/

wybor 40-mi-15n06 102 cm (40...

-

electronics

https://www.uitvconnect.com/b2c/wybor-40-mi-15n06-102-cm-40-full-hd-led-television

jealous 21 womens dark blue...

-

womens clothing

https://www.uitvconnect.com/b2c/jealous-21-womens-dark-blue-jeans-jealous

women's black & pin...

-

womens clothing

https://www.uitvconnect.com/b2c/womens-black-pink-velvet-net-lehenga-choli

fungus knit wear t-shirt - b...

-

mens clothing

https://www.uitvconnect.com/b2c/fungus-knit-wear-t-shirt-blue

g.a.s tapto cricket bat

-

sports & shoes

https://www.uitvconnect.com/b2c/gas-tapto-cricket-bat

adidas eyota m navy sport sh...

-

sports & shoes

https://www.uitvconnect.com/b2c/adidas-eyota-m-navy-sport-shoes

queen size sofa cum bed

-

home & furniture

https://www.uitvconnect.com/b2c/queen-size-sofa-cum-bed-free-bean-bag-cover-xxl

l shaped sofa set in beige

-

home & furniture

https://www.uitvconnect.com/b2c/l-shaped-sofa-set-beige

sound king sk8500 karaoke 4c...

-

electronics

https://www.uitvconnect.com/b2c/sound-king-sk8500-karaoke-4ch-amplifier

roly girls dark pink with se...

-

baby & kids

https://www.uitvconnect.com/b2c/roly-girls-dark-pink-sequence-work-top

roly girls polo half sleeve...

-

baby & kids

https://www.uitvconnect.com/b2c/roly-girls-polo-half-sleeve-t-shirt

basics life men's red c...

-

mens clothing

https://www.uitvconnect.com/b2c/basics-life-mens-red-checked-shirt-longsleeves
view more https://www.uitvconnect.com/b2c
- https://www.uitvconnect.com/maicircle-prize
- https://www.uitvconnect.com/link/user/auth/facebook
- https://www.uitvconnect.com/link/user/auth/twitter
- http://www.uitvconnect.com/link/signup
- http://uitv.in/helpdoc.pdf
- https://www.uitvconnect.com/newspaper/demi-lovatos-private-photos-leaked-actress-says-its-just-cleavage
- https://www.uitvconnect.com/newspaper/virat-kohli-has-become-donald-trump-world-sport-australian-media
- https://www.uitvconnect.com/newspaper/kate-hudson-sparks-dating-rumours-musician
- https://www.uitvconnect.com/newspaper/david-warner-hopes-glenn-maxwell-can-continue-playing-test-cricket-long-time
- https://www.uitvconnect.com/newspaper/actor-george-clooney-surprises-fan-her-87th-birthday
- https://www.uitvconnect.com/newspaper/cheteshwar-pujara-gains-no2-slot-top-icc-test-batsman
- https://www.uitvconnect.com/newspaper/tom-cruise-spent-year-training-sequence-mission-impossible-6
- https://www.uitvconnect.com/newspaper/casemiro-believes-striker-luis-suarezs-absence-uruguay-team-will-help-brazil
- https://www.uitvconnect.com/newspaper/mel-b-files-divorce-stephen-belafonte
- https://www.uitvconnect.com/newspaper/goalkeeper-manuel-neuer-out-germanys-world-cup-qualifier
advertising https://www.uitvconnect.com/advertisers
b2b exporters listing https://www.uitvconnect.com/landing-listing
b2b buyers listing https://www.uitvconnect.com/buyer-landing
b2b market place https://www.uitvconnect.com/b2b-marketing
b2c marketing https://www.uitvconnect.com/b2c/
about us https://www.uitvconnect.com/about-us
privacy https://www.uitvconnect.com/privacy
copyright https://www.uitvconnect.com/copyright
terms https://www.uitvconnect.com/terms
contact us https://www.uitvconnect.com/contact
- https://www.uitvconnect.com/paypal-payment
- https://www.facebook.com/uitvconnect
- https://www.pinterest.com/uitv/
- https://www.linkedin.com/in/uitvnetwork
- https://twitter.com/uitv_connect
- http://www.instagram.com/uitv_connect/
- http://www.youtube.com/user/uitvnetwork?feature=watch

Zdjęcia

Zdjęcia 93
Zdjęcia bez atrybutu ALT 91
Zdjęcia bez atrybutu TITLE 93
Korzystanie Obraz ALT i TITLE atrybutu dla każdego obrazu.

Zdjęcia bez atrybutu TITLE

https://www.facebook.com/tr?id=870968186334403&ev=pageview&noscript=1
https://d5nxst8fruw4z.cloudfront.net/atrk.gif?account=mtx4h1awa400yq
https://www.uitvconnect.com/sites/default/files/uitv_logo_new.png
https://www.uitvconnect.com/sites/default/files/uitv%20breaking%20news_0.jpg
https://www.uitvconnect.com/sites/default/files/us%20president_43.jpg
https://www.uitvconnect.com/sites/default/files/peskov.jpg
https://www.uitvconnect.com/sites/default/files/paulo%20dybala_0.jpg
https://www.uitvconnect.com/sites/default/files/donald%20trump_76.jpg
https://www.uitvconnect.com/sites/default/files/tillerson_2.jpg
https://www.uitvconnect.com/sites/default/files/formal-salman.jpg
https://www.uitvconnect.com/sites/default/files/virat%20kohli_38.jpg
https://www.uitvconnect.com/sites/default/files/kardashian_0.jpg
https://www.uitvconnect.com/sites/default/files/james-b-comey.jpg
https://www.uitvconnect.com/sites/default/files/styles/news_main_image/public/us%20stocks_11.jpg?itok=aevmei_h
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/adobe_logo.png?itok=clqwrpfl
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/tokyo%20shares_0.jpg?itok=n1pbpyf8
https://www.uitvconnect.com/sites/all/themes/uitvnew/img/avlin.jpg
https://www.uitvconnect.com/sites/default/files/imageblock/b2bimage1.png
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/2_862.jpg?itok=vm63yo9a
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1_989.jpg?itok=bh__nwbk
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/01_67.jpg?itok=10l617my
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/3_625.jpg?itok=zy9xe3oe
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/2_861.jpg?itok=ulx1hbpy
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1_988.jpg?itok=w43b-k6c
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1_935.jpg?itok=hwxy2jq8
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1_934.jpg?itok=8wjvxwdc
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1_933.jpg?itok=ybmqfi2x
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1_904.jpg?itok=vtp2cqql
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/sisa.jpg?itok=lh26gsjm
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/dress1.jpg?itok=vo3zch4i
https://www.uitvconnect.com/sites/default/files/imageblock/b2cimage.jpg
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/wybor-40-mi-15-101-sdl221953195-1-5e37f-compressor.jpg?itok=518-jnqa
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/lightbox-1jy11441-compressor.jpg?itok=rdeaxinw
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/lightbox-d8bb72-compressor.jpg?itok=s1s_i6lg
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/lightbox-ccb642-compressor.jpg?itok=696tv4w0
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1-7dfdb-compressor.jpg?itok=za_qopkt
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/adidas-eyota-m-navy-sport-sdl879230173-1-6e518-compressor.jpg?itok=sgfe4uqz
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/dolphin-double-zeal-sofa-golden-sdl614758854-1-05b05-compressor.jpg?itok=rfdhvmbg
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/amar-furniture-luxury-beize-maroon-sdl642252154-1-dbe23-compressor.jpg?itok=jngqmagy
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/sound-king-sk8500-4-amplifier-sdl981926304-1-eff76-compressor.jpg?itok=nbk6jynx
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/lightbox-844e08-compressor_0.jpg?itok=ik9ivmk3
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/lightbox-f530ef.jpg?itok=w8dye90_
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/lightbox-11bsh26359.jpg?itok=agd95_yq
data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wceaaggbhaqea0qeaoodrandhandqonea0odhaohq4xhhuoebaggc4bfrgsixaqhcsplcylndq0exstms0mmcinkcybcqkjdqwngq4ogscigyitlscojycnmicmjyynmictjycnjy0nji0nmccujiynjycnjiyzjzmmjycnjyyyjiymjv/aabeiacmfrgmbigaceqedeqh/xaacaaeaaqubaqaaaaaaaaaaaaaabgidbauhaqj/xabxeaabawieawqfbwumcgeeaacbaaidbbefeiexbkfreyjhcqcygzghfejsschr8cnicrlhfryznfnuc4kss8lsjdvdrhsdk6kj8rclvwouzeaetmpirf/eabwbaaefaqebaaaaaaaaaaaaaaabagmebqyhcp/eaecraaibawmcagcgawqhcambaaabagmeerihmqvbe1egimfxgzgxfdkhwdhwizm0fujs4qcwu2jy0vexjdvzgrlc4kosomp/2gamaweaahedeqa/ajiiiuunoiiia5limkttnqakqyatsna0ssaazzobfryn7svh88n/aorj96yx/gkn+nl/vcsjsnplchs8kpqrhdjn/dio/nk//vk+9p3yqp55p/1zpvweicx7ps/wr5izf3yqp55p/wbwt70/dio/nk//afzpvweia+z0v8k+sm392kj+et/9wt716mwqnp8atjwovayfesnovubekywq2ibj3wp2lgoh54pmduec6vjf3v8vozmoivjfk+vt37wt2sm+xz8fqmtqmpd8rn9yn/hzonn4lz09awuge4wftzrsntqhql3cmaeyt3b+sujca0aob3y6iplk/o4w0ahzonttnaktq0e/ur5ltl/isy95pnypug2+wt3g/wcvk6bbqj92kj+et/8avk+9xqijc3k3kxttflhsg7ghua9cdz0fvfyl47gwoy8ynr7e5nmt040zl7q+s+zkfuxufzyf/qyfen7svh88n/6sn3rdxium+z0v8k+sm392kj+et/8avk+9p3yqp55p/wbwt71higps9l/cvkjn/dio/nk//vk+9p3yqp55p/1zpvweia+z0v8acvkjn/dio/nk/wd1zpvt92kj+et/apvk+9ysid7ps/wr5inpbvxjj8p7sz8mxsrz3udb172vtsflfdoav96/5x+ntnmlycf1qkjezsw230qrettlciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciial1luuje17dhn2vtttb2lvcfzl9pqvif3l7ibtfkfjqvjf+kyf/w/vc3ugsf2lr7gf6qpfypp3fveerexdhm4reqareqarf4uaeovl+k9qareqareqareqareqarfdjp3ua9zynubhri9rxoawdxo5e1daxiqtfbareqiereaereaexl/feaeoiiaiiiaiiiaiiiaiiiaiiuyuz2hjnrpa2qxje5rmteorxfo35ibsfsb4lsirr6d4a15iegp0zk5rgxx6ndsunpak3wwkrecberabf5cduv4oa9rexxqaciiaclihozxtc9lpk9jl5pwrvcxthchzgldqgrgsjp8dnfrdo9rzendk9rnsp5xszfnkyn7mnslkocbyaefyye0+acwt2j1exrw3iafytynfysb7ac0oh4iutqoy4tfg6nw3y9rmugnnp2vmczcq1rxoc45wsac5xpqabpmrgrdlzjuuor1rsyrknkhfe4jmgsncx2xryjbq+5wujp7orpp4yresiberae4rexk57kereacnxj+mvp9pl/efyszcy/jft/ty/3hwept1g3/ajufcvoereewxq8xqammngcdohidyg/vckgh0fgqy5y2u9anqynvhd5saxafgyjsqi+c6q+da0fen7fjske0apbflgwf7eeoe1h8gtao8fakoo3gy71y07fp9x9fk3lmq08war92nawnfw54af8ay3+elgoadwqqkdg4kkua1hdz3gyqwa7v5je24vykb91u43h5qig1p7zchwdmfjbz1ys3s5118lq8c4fkikesuvjy/eea6xd0go942typootihcjkjkdsxr9l9nvazwj0rw52lzyx6yiiz6mc9hearm8fgqqnl5urogcmkex8xoprkz4rkblgdjcf7kocwpt1dclo9hukrgzmb/kgu+jnzzvadeuy90+bkt/1/dk/p2bga5tt/skpxp8nv4pjcxareqkereaereatlgl/ahr/ajx+ntnqzgl/ahr/ajx+ntnmlyefdc/rp/d6iiijpkheraberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberabv8b/xtd/636ovcr43/imh/wbb9ulc9h/6pgh6q/0uvh9uqrerd4ebberaberahhpt8psaxq54abckaksslfvvzena029e1yguiiy0dbxonxtnjpc2zgl5hb9utje3wxsuommdww0lttjt2xh7g1nec6n4aczrzt2y08fbz948zhbvexybxs44pvksvma4xpvzf8v47qkqgsf9fff2mxlmx7i5jq8etsrrcc3ldvydwnvzsegzhe1wdmizxa5w8agkj22wop6vzzinswynhbpej3uy4naztbmdjaw0juo9kdhljls6sgjrhgmmzecozb6botlt7bc02t8kspuclo+er8i/aysulrl04ss25i9v4dpdnfbjggpne2oj5n43fzglhw8xc/nbzvo/rdi5lornajnl3dksfmju5ifypfxasicaexjqpl1ahzvxz2hak+21/gy0nprq5w1npkqzyhfb2zbg9zr2vahvkc/vcjjd1ztrjjo/4e9tpttrjkc8tjr379maotwcagoip5a1r5nszg+5mbsz8odmte1zrpdbvvo/rdi5lornajnl3dksfmju5ifyphx2p9kwm/8a8a0x8o2i+5ap0o1cramnyvmsqig7zgje5o7xtd3yofqhebqrpso4y0/weqdntqouu8tra7+f/uj2lypnsyckvlnezmlpzncl7t9y28pady5gdliyslicr+wujytybjcqy8unya7bm9rgafu/sebswf2mswt4giw6pegvnrxv0vtf2bo2mhnfcgaeo1wgiltc5ro+cdk139rpy5x5zjf0ejgcttysplfgnv3ggrozrl2hyu7bnk7g135ug6+a38navw2j8r3qmdgoe5jphzg0c51ds3keakgfyrtvgmokhcxxonc+osi9sje93xnbvky8trqgcvufq6sqzn2zizjoy/hmnyfxigdblliv45lng5qvjkmclblyvp2fchtdsezb4wpzjqeaakixhkpyx2w9sxymmwmboxttugj1vpmgpq+omxnkelgiopz4zzl2pkbiymcr0vm2iita/waoeeyxp4ea1mz5s31mzn2fccfhqa38ivec2zclxqagisqude9/kjl3vxxprlu8+sakpuvvgqcxh1m5xl+vti5qcjvm1pfurbkjzswmjdnctr5as4fuuc7tzv3fedaqmjmrxg5g9cxulizxdwihxldb2gmezh3mx7o3zjwh7cq4a1rgbhlosved5howjewvkdiizvmznjcqz5k12w/s73h2qz3vvzlthswvf062lphvqcdxoxg8f4xqksf0twnydbtpswtlujbak+5zu/a9vgyokf2lw07hsoje452hhcthzvgd7ld4ix7scpbtf1nrwgo7k+bkr+v219bfwuq+hypg4jxcttlcgs7ltl37lstblfw186jxdv+ssyzjhcidmt1injny06s9jnil/beartcapqbegakbh9vzg27nohmaeac/yoezyex2loxazm1fbxuecnkpbmio+sskwfbzze5wr6co0vvm/pfkfs4xjzwm0vnmuk9jrw7ltyvekcehrzhzhpb1ybtmewq09dhdtie0744qm0jphkkcopm64zm59nusxz8fqindm+lldh3qaxzg7xy4czh5kzyqx5wwqbbnbohttla24kdxl3m23dsmxxuetfckls5e2fzldn1b2o4xgvgoxhld27i0gk8g1vmwyozhixou98li7korgqdb2k3rcj1m0evregsnlcwnjdncqwkls4i2uc7tzui9gnm6kcuemztn3c1sl8gov3aka8rzlrygnc3h7ng98zyyhr2ktegmucndyniuyv3vi9g2u0s9tysn023mlv3uxfvgd1jbpq7gasidd2bjs7mtywulnnjoma4fh47k1i3b9ttr9rii3mfs5jcxflza7gqoo2upfwpuydb649vixqtq+yklixstbmgv3kxjivvhlznyjxh8j5mjksnmji4gdhmaufekpptdzpfgzwxf7otzpadwzr1lfjbokthcplhhnjecjznwaxrnzxqqxpu2whdppor1xwnwrujaims9q7khrojaw2v3yqmo0ov3rc9s5vdwljhrulgsztjdsrq0bwb5aoi9qrgqjp3vl3byzwx8fbzj2mx5yw2zb+r3uo7rzysyzgf061xh6s6nfpzizjfctrsna+umcxxy54nocguts4eajmqk7hywgmhqnvimc4jlgtc8v7zmzcwy2gm+qkrxudw6s97pcgubnes51m1tmgnwdwj2k5j0dpmgw7s2okymphodaxeaqwjt4ehojd1mpsx97dgt6brxkum/cukildh2x5ga7tiuxfzlzp7tsxj6uw246rmzwrvuba5giekhgka5rnamblbvjdot6w2vzw7lp3x8ppa9hy7k52rwinjw3aspeob9q94ylemjw9rjxx9oazjyxxaxm+suow/s7g+5j9rquwi45ahf2bbxhrmntfse/furjhugkijahshhy45rle4uahw9u3ai2plkt1imh4juu+gxyy0qjlcxkbz2we5/yd5azu7yd1rr25n3zvdi5/dwc97nua2mdo4lztkwnbj620vvj4xwjddx3qaxbsf4njzthxnnxzjkbwswnpspkbjns4qwm+bexmcu8embc11kyojsdzzj3spkl3tdlixsbnr3tdapfxxddaltzkt5krcyuy7x5q5pjvgjljklde3h7dz6u6dz2ubmte5rtnmczmwi7g2zw8j7iqszaw4xggebrmxdmyhkizfzxpsumqqy0wlj53+jpwt6fivyu1p9vcbj/ajuh8gvuzgybsctx2ygd5yxx2s0anyutfxyfuqyshfce0k/gmtich/onmpzx3h2hyyqmuqayinjteyckv8a72rswhca/yb7aadddjhflobhrqr01znry+rldurvkg+tvbi7m6mau9u6c9bakwf7vk+m57y48tyrw6tbwjhvgmb5589u3snzvccvcut5nmanjy6r7o0dmdqln5uxl1uyu+dhvdjhyiqp+3gqmtecvazm65ni3i5aryw0plvqbhuaeqt2lavrnt5xsxgzup2skdi6a9v985z+h0gmlnrgugju+ma5rjzajkdh/wbmvbxgjry6kao9aslme1vxq7/1yx7wtd6o3524jse2esykb07zcx5/u1k1tuawr4eptuwidjw6aukyiwt7wuwbwttlsxnn8detzrcady/8kj8c4kpr7tdi/epjdyuv5an9fzi+/wdyao5hobvvexznylssoe+ar2vmyuuqda535bthiip5jrypbr1dvdw6d4smyhj3nlwdikrfgvk2nzfhzd8oed7luvaggcs+/tt6dawxncyawwq1rsnpvgecqtk0uxl7ecxnheppg55y2ujvyzrolma9hxai9yyiudkp7az7bg8vtbi0tc7umlac0hy6esnr+1bzh6mx4jxcfmiw2o+ttkvpf2qyhgo3fzwv3ha2wlbcpmuz4xsq0ctpyywvddt3ia7dp7o1uv2urnqszzj2fddnttlqvontqx3rc4bpxq0gmrols6kaqy4tjlb/acopy2+xq3aehkirh5jrq1tmumkjawot6twcsfihl1uq4nc44xipdi57nsvrdi9xe9x+rx6lx1k8w5j34a4u2btxneh9nftp4z+ugmt8l/zzmjwntc8ctpewmnbuq8kec6vfvhd8bgxwxbpqtd8tjmdcx+usncw5muyavoza+bxe5qath2vlhhwgsj0twywa5+cxnrogw2h0oql/cvpkzca5snawtumes5r9l8ngjb62zdp8vrofmuqcjr6md58n3xn1oju+wafpmksu6s6cps9qylwtqvefonhr1xp95pkrh2aoljq3gpspmpdqx9oa71srlsbtz5hzdnw9vrchqms07htzqimbk6qkvdq0pbl2scty7kxyo8tsxpdyxc0lbt9izmza1zgp+2d3rxcs1agiylsnpdpxwvdbbmxbraelgw/2077zumtpv+wbj6zrps177ys3/vzwzr8u01y+tyycqvnliyioqtowbmd4au4a3uhkk/cy2ehcdvcm1jm4rfrkij72mes9rc4usmtjbwk387m/u7chb/uwey/ppld9v6vakmyudx+7yee30qqwugfs/kttvo5ct7+n+aaq83drhcwnpvhts6uazqzy254wo3tzv6rinpxcfjwlzn0ktwsbckum8tgfjhggtdm2wiuav8nen5w3uy8jzutqaw47dm3bhmalxk7d40/qmrax8mguuiy1l66ufuxvektokl0tgryri0heyo7lsfmt1ksf3oeiwj5ewcjqvtavwropu7vhome32np3nijbbbbic03bbb1bhlzely4/vxtvdvjcsynvdmktew5uzbnu0gehnm3c1y2kctuvlzoyrqvopkcecpgqiinkroerf5oeyherahj8y/jft/ty/wb4vhlnxj+mvp8aty/3hwept1g3/lr9y+greqtberaf6fwbfmbzuwbue7mtpt1z87cru1nd3wyvtkhh5g2b8dgtkfczjlbtu7qn83okayv6tfs/f729ncm2g4klsa1xcx0zymvn80hbzttupo9mgecqbizncinizswmseh1xste4ohcoyc3t3kj09vlcyx0ijfb9itnz8r7lq+ppzqgegxspykbi+ui3tbufhmy+nxcvf8a/b/lpxnhw14sag9rtvvkiefykd+cbx7jw5elvyym1hixs5ndqr4w5jnncudyk1e3lmvqqpipny6kswafgior9/vpt78heiiutheraberaberaey4c/3r/lf41m1doav96/5x+ntnmlyefdc/rp/d6iiijpkheraberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberabv8b/amuw/wdrfqhukvjf+kyf/w/vc3pr/wdqkyfpd/rs+h1rberf3h5sereaereaelowrhqykbbt1nme3+tytekypvvnvskwktj04zwjljnrr1kmtvn4zt8w4wrauj8mwpmxszc7yy3gmzrg3lzbud3krduncqp2cjksmzgjkw1lhoe1ttbmdhf23wmrq/zkwntgsf2lc69erfgyanf6mweopmmes0l2srnlbrmlxhwagc2lwl63pvvy1je9a4sttha5sfzaqte1uxmtcguovekxet1qppppceurytjollzuza4nxvv1l6asvlmhukomhebjq0udmmzwzdcdwbw5rfxrgj61wknbc1zy+yaha9rcuym5bcde8viikjbu4tnlgduvq9rnslzz8dy43xfu1vzduiy+wc50tqdsrhbxtqsxnuzrayz6f0gymxoznpprcwlmif2m3pk8a+5r9ejtktsjjgeupxkk5qw7l1tie8kxqtnkqc4pe0qywcg2fh0saphmtw/jzexmdg51m5rmlrpoycjc0tsdn5efrafesrallgvwnhf14z0ye/js8g4pranhjgfc+mkueu7hpdhe6lhdgdel7b9upukaunlvg1to5tblnno57jmwfi0b2szwannnd7vreso1pnt45fj1c4iklljgz4+ikltj8hdypk+vfyydtrnn9bpl3p0dlvh/evttwz08tidfuf5kmjzdim0yacpdwbo0clrksu2ptny5efinv9wullvulhe4lxccokxwz6iwywukebtvgoa4bub3hye9dudprri8vq56fdkn5durvqaosrtjzynbnbleuy52f3h27rmub5gemkrqil79hljffzykxvloy52eswsz/wdktpfi7+0t4qpoylkpl4xnptnkn1afojowpyxjd7ftroq4jpintlhmddk3arltvoub0cnnivafwi1fkk1hmjtlkmtuxhm+z6qctay3phf/ajtc/p7g/l8fradgqycwwekdofo8ytxoydc9xn7lnlc6ggqy2nvhirk3plks5nf3tzjpubyjmxtieuq2goawkoi+vftscwphrzi4kjwurbmbqrsfiqyd5pr3i1/bazz/wz5dz9hzwmqq7niqfnlgpb8rzuq7k5ow7wpgx6thkmgnmpy2wggo7qsoe2qyjozk7k4pagg00968pmbqyaealjbayzxijhpbizrnzldlchgdqaae9wcngvcihrpvo3o4iukyxh8lc9xcon1pyqujzb8nfu+gydtpnn9bpl3h0dl4mcqrsmhdypk5v3y2tttzs/rz8u5+jsrwrc1l4npy75+io4rc6u2n4erwmeqrsghyqfjzfv5zo21mz+tny7n6oyuyvxxw0kfzqvhfgl5gzsc8x3ooyq4aak2n1ilqocxk6fnpprl5+jh9ruitsjldlhwmqp4prpyjqeawkvlq7m+rzhcvursgmicggd0cuz6qjeoiqmohgp5wqcknldg6nsgkowmtgyl5b0ceswzgrdk6nvswglxur1l+4kmps5wpgz0nefs6k+qlshyftv5zo20mz+tny7j6oy9xhigpqyiaavkaipywxmnsgkowmtgyl5b0ces15rovvttzjvn4io+rtaxlbgpgjcm4yrxaabpbjgyzd2sjhgyr5bwzbwbnuzbpmswtx+onpoaovkhyqcnrhmbijtkjytzolydoddfgokvrstyl7r0uoxelpcu2pgbrd+nsrp2cnksm7gjkz5sxz3nb0zhwj9t1aqela6wacdzqdslpn7emioqzm2de7itooq1si+yus5wk+pxlioutx+husq42xcdhjfjbcx4lxmny5r3ntqmxebeyy0jryadf6ifsowprefghr3nwu81hkysmxaakl7adsy/i6mtldnmlsqdqha7thpkmiytputcpl7msjs8oidmxtym7bauj3135rfrdowcten+av1vvnu0/vtzj2m0xnieqrrgyobttbe/tgibsjsxzsluu830lverwecq1dhmfpkwscs400zs+ln9jtic32fycjv2ano0y2h/bq/ielq9bzm/goiqutabusseyob5pc0sjlurdcku969q+iqmanhpzgqcgn7mruy2qsnizk3m4vioh1sfr0qramsyxasvq8njuxoz9xsadikpp4z6ejkbiqc8ygrshkgamnouh4a0aost4nj1vrf3yerha83fbm0vilrwzgagg6dy8husjert6bzlc8hg9rr04l93zg5dxpidhub74jg1lcjmuzjanmqjlca8w9ynw6wshxqeie6snerc9gje2zr3mtmudyoguh58ysneitaai4pbmwv/xlntct1x8tppoikmgplrgdiz584ka9rzfykhkghwitlbbxkruultvqfljuzm/amldbo7k7qa1uxne3dhnyqjvb00847y+a13tzrdltnpxm3escqameope+ogefjwrsu4c0ns5xbiljf13x5wwfu8d4li1rtlbgguas+knzxywcdlec+gntbzdytgia7sk0k1wpj1g4i21j78mzien1ntphuvcygejjwrsuwewnac4g6un/xdflzbznpdxmdlekd/+z0umfz0eg/br1eo0pnjnccx6jcrbkpc8lukznue95bfi90jyagjmxxjty3kprfolhyrsk23lherkitheretnsoreqbyfgp4xu/08v94vixc7mg7egh3rkxj+mvp9pl/efy0hrn/sh1qvhqfh+th3l6hfg+jhdcafkjtv5wb/adlax30eyddtvmrkuh8cl3sjlmizbuhtmu8jkfh5bariqqfia3/h5p1vvyou8fdxypkaxu7x1envnz/if6nzos7bqdslttrvf2ytxrvg12l4bhxwctnw7/hkp/iyf70lch95hq9w2qumvjnb/wd4wwz+ao/6s3+zahjhgsgpqkomipi2rjrkczjxwjcbexpiul9qffvsk8hdavyb+ufuvknnqb0rjypllpqd5k4pxlvm05l+8/ne0j3b/avduunnnltudji1xe4ssnv33dyg3ile/wdxjhm3yr1unazf5ldeguicwjpkdlnhalha0ioytkdn75ub5hzjhswfu8ay1ex8kmdxszg3m+rzjaa3qe+okbo6fmpb/d/kad1t6m7ifh1dttwvfs77lgr8cr//abhhn80d/wbwb/mn/wayyz/nhf8avm/zlp4qx59zsrtynyx73pbay+xr5gl/jb7tqrmavksyor5gpw6hf0pypzqzynh+s+v8sjf/abhhn80d/wbwb/mn/wayyz/nhf8avm/zkjy36vkqcpqiw09owxsuy0uehjao5ozbtgr0ksvlsyj44y87c6j0ecxencpuelz7fapw7lpws+40puotro+o5z041z19vdk3p/xhhn80d/1zv8y43xjggo6yefrbrg54gbn8mrol8+y9i+ke1c5x6yslznpqpo9umctyorsfc73pluhhw8xxbn6pdwru8votnyutt3nd7fp8tkq7dghoyojs07qinc6z8bxyntjg2crflyhlcd2llncgffkq2miiu3ohyf0bdxa+63tx0mjqolgipzljznp0q6luoufgjjxf3nh4fkvzii70y4yntsoagppazf5lxlib0bqjrtrdncxxzgmznzgd65jpndt9inehyaikdxwkqlwx9qco873fwvn9jfai4jfid6lfaa+uvwqsceem21nu/ht+jmeav96/5x+ntnqzgl/ev+v/juzwzlkz+uf10/h9eere0yqiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaq+n/4ph/9b9ukhv8b/wauw/8arfqhbno//viw/sh+il8pqiciilvdzyiiiaiiiaiiiaiiiaiiiaittr8ovmszlbtumbdsdnecywc1jsf4cw+wfsxllnnd5ryaqb+owhv6l1cc8/cxafhvqvhhffbk9hax4c9+q1wffgts4gclkjdq3ukx8iut02a0rhtmjhzg8nscabp1lvn09xhlcnch9mbfwgmycgeqoz6k/wc5h5mts6cv/wak/dg47fwvwovajk0njcw16wwlng9qw2dsytptkv3hahguimu/ddbjk7rkipfcegczdqfstwoolq9doqjqc2jjlhykewi3b3hhbkvf0rmbt4hixvvkkjjw5mdk1oe9xp8athc1u4ub6mni+tdmw5c7nody9ydfal1cedmt/zv+jqh0wrubcx6vzvzv4hifssnwgeo1ijuobnenhvxt6tgymjlvybxtewnfg8bwzftad2rno8dbc9ur57nrsgwmxy+tt7eahqdstxqlf2lij0gev4r29hzehgwsnrxta0uyl2yot+dbmftm+jot51yzxytd8f0kbeqplqfz8phwnohrlwpkb97/aohzco4akaay6gseby4faorwaee2kgcoeyaltut12kanc43e72c1srcvvutpigfvs/pwtvjc3kkdogzzv0gn076f955ia/skwm0018djlyyrmvs2pgwu9nd7ga/whuswi+ga5lyenydbtghtbnep9iqc7zj5k4rmenhmzxy1yr1swf7sphqqyq4gr2ymyq6s1ltkr2vmqtiasywqksv/kqxns5e0lgtvbysiypypviy4gmwq05izcxwnnt1ihntmitsqvmditezxg3man4q1nspygl0bmh+rs4ex13ckukvpuplfbjotzhw/ii3ssdyzczytm7xbclgiwezxa35pjme3nglwbhunkmqtdzhu2qlgyvc16kp7c0lp0ltli8el1spuyf7bfwymm9m3slny6qhjkairjjliqcbyx1nviths8pvuszlzsucwdmh6d4fmjmklomewsqptn91n+41il1wssclw3b+ohejxgereaereaereaereaereaereaereaereatheretnsoreqbyfgp4xu/08v94vjq+s39ifwsngp4xu/wbpl/efyjdyg9ccpueouf5mfcvofstazqa8vsws4kq70dwl7wp+pyudbcniohai9ysyge1iljzw7rjmx8xuule6pgoptutfznelscbnqqk/4ih+8cs1mhswulzinninr2nj4tpmlz8myrljuqv7nwjie2r8pbdqab2b5nrc9cetawnz1+6uast5vns04e+fyd4+wekjnhlvfd6kdqz9ckv5x4rqcz1o+rygn1yxo/tfsw9v+4/cetwczdu0v8ufqizejx4/cyi/qf8a3rlc49ep3orf6l/efooc67lqugvsx3945vcy4hmoaox3zb/uczh+t8pylvb/amtl/wcy/wd3fho8qmuhwd86x+9cpskzxua4lntrqjxk/vxlfir8u6h/kj7kq9v/ra3/abs+rop8tuvwvz6zp+tyndwohljlyboie17t4g7ljx116mopwv/1rxlcqvfr+9nqljfstkcxw4x+ipozd8zbnffk092rgepdty+wowhxlakmlqidy5hcz9magj3ln/agnenftud6v5sp9envae0g+0qbfk/fblkaq08+fj5dfw87c8cf/deyv2coivosomnyipc2x/i8d/o7/wdb8v0r5z4qm0usjusnuvuzz7fnf1yfishidhowp5hg94jjh+mrv7nsilbuqeh2c/up9qu3ok3k0kvwsiv6qcd+u1tmtdeon/jm6f1+84e36lel6xxnzqtqt9q8whvqoc3jnqdhartbefgpzfn938yzcbf71/yv8amahnax+9f8r/gpmojcnfdc/rp/d6iiijpkheraberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberabv8b/wauw/8arfqhukvjf+kyf/w/vc3pr/8aqkyfpd/rs+h1rberf3h5sereaereaerbxb+h5qoniaxjdx1el2xjwvztzzjbzk9isntnulpgss1krldyetnjs4gghypnbyvwgukoa8tqbmbli6mlgjgbzp5lvy3ixyljrbdoiybmkdiq6xoxj5khxttwlbputu10qwt4kuxhyfgm1qxz4sjy3eapha+ybzviwnc38m6kejwozo9a5z0lbaeaykovkhahwtst1/ltacadfqh/k62e3efwzijjdlfemgnc09+mn1jhbwthkpqfgo3yljtouc5uu+2vjzxktrhjigodjwrrpuxoenqhrpdlfbkfxjmb05hawbe/o15sxnd7fnlw+t7ldcxp6qovtthszqyptd8jjferbzobv7vtmfoqqeyyvqz8jweqvemrj2vi1vfzczjuvh+jgweb9o5c14fsgx54wsefs/e5vkld4zsjwxymee6+codmbtb3stp4ldsyshacsxqj1i2/urcd3saa9zhpfm+slvpxx6lc+mekaij5hzh2lxmicxzxod4ti23uekcq09k+pcq1qdrs1y/bdy1jph0jxjdtwvy4nkjvnjxubmqt8kyfxsmdztanmdmlqp2gy5eyab3huwo4wx19o8thy2kddxn7vt7tkuruk0rrfziwwtucxxcb367ek3cnuf4cyrd7+zm2sd3jvpzev2swkzy9xl16sw6iiiiaiiiaiisvlwgoln5by3f08ucn4izxdjsjhyxrz583zm2swc2w5nxuokg+0ncm5ptpnbteqwnljfmyvjnenc0kvvfuv67radvs0yqmfvoyuzsnuer9sjkvcquzv7luusdsw8qqyy5an7e621nr7gc1wgpzjkxssuchnia9k5cw2dygncrfuecvzylftb2ekm8jfzoco0yohbz8wtfgdc0vdj5tkbvhmvldvhorml46tuslcezpzbklwf1pifsaquwls1e7dq1pyfhn+hku1tvh3z/k6cvew91ozti8xfrdzclet31apmtnik8l35oyhrx1ccrbn+aos15arvkold/iz9zlvltt5lbyfvtbwh2k24lilvbc1tplsusqjxgwe3y7t6dhmz5kc1bqctkewuec7mggz7uapfrnmqlzvae1koxzng5hku9onoxuzfzgsywa4xvmdmc7+qsbn9gwpu4jlibvnkdbqavog6lx7fjugqmjcpocnopu4y8fklyvwoobf27ohni0/kosdvvl3wut4yuugmncupvlbu6w2jnxry9niquroq0qyqccrmaijb18l8l03h/i2crpy+cuoya1kjs0w6h+x9wxmfxb7bo0x0ub5/ufwulenvykxlo9qw0sw3z2jhjndebpoy6n5lfnmfi4va9jw9srso1igfzu7ssslmx9vx9vwvu081segjkkydjtobe6y9+ctuq0cs32kq8s8m1iy2q1clxkbziynys8wn9ygvv0pqnos/mtzt43nkvanbp+zj9x5kbrzkue1dg53usrw753mcbbqtyweryknwzmosj95ypure4aerexqb6iiabe8hugaiigaiigaiigaiigcciilyc9lciiaot4x/gkn+nl/vcsjzumfxip/p5f7wrcup6jb/yo+5fqnpdfezmjizn5hmgvkh9vzeqjuty8exbuoosfiumq/dvym9sv7p0xoc0an9pwmaou6l6kktudw3klndp8z9jx0wdgbpve3j5k+9cobjtsnqux+0sqx41unerl/tkkf7ft8mzp+qn7xqh83/ynuqipzgc6srsyg7ned3dvz3ibhxuoa1lxfhstcf7vpech0wjkkljdznop0neupvvcq171zjpisi3ok+jmbwqq1awqs4s4t8/b+b1thpx+su36b/xcvojnh5jufoj9ylmiqh2a7r4a0adnwavsb7v46d5fji8joxoi9ykv7hw9ghxgqt9gk0rt19ccowrg/nk6pwmf9eh15yf3rluw7x+ixhm507x02fz1xnah6r95rtvoxgo44eu/rwrxrzqqolqbfd7mzjh8yn/pxfwsferxz85apnnyw1j0qmkb7jl5izmmrtdlhipmu1hvvme4ldxjmdghbwica4htyjf4rjirzn6r959ys2114saayje630l7fkm4suzlz5xk/wavzox5vh4hqdjpeu0leqn2wjx9m7+7t4qndofph3lefs173xiausfppfoy7s4vapnsxwsd/p4hiiizzrizcbf71/yv8amahnax+9f8r/gpmms5ppuuf10/h9eere0yqiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaik2z2a2mjaehc0fbkk3wi3guivgvb1bbhuwpxxqbqiikaiiiaiiiak5fcxxowg7jf3dqvyym1zs0bu+wdvktosggc19grdc+jksuqord8dc5eewtc22j7u5nitfykslic3kq2/fprehh4k/lelagkj53p8aapj0m/d2fexgirrota47w6j7ryvpvzrcxhgnkiijooreqareqareqareqareqareqareqareqareqareqareqarf6gdxv8b/amuw/wdrfqhxpkrra6c/5zfiosp45balw8dm22vzrsvvdbhjxsbrhekltspy9n1rakxi9xdhm4reqareqbxda57g1jc9x2y3c+ackelvietgrywzgi2a2fztkigwntvrwxrnkq4y57wipvgf2uudya3qup4tirygsumz5x9nffomz/pkfm3dxpqkglm3enwpiuxvc3htt+zcsb4ipmsbtmm7z3xm+uzwsv1jlfccjq/dqz84ej5gvayzukxfgbru12hw8xvg9lvz7nbkxsdiwwag31bhzio1lwcye++uyrtldxnylpmrns/gdvxhkhldyazyvaxato7ppruyys4l5l2r68mqlxyjkkrqwps43brpkzgdg9g+c/md5lyzcyryucklosjjpxdbajovucqomsoiglpy+x7ohjrowxe7z6kaks0lfdjh8gjmgpcc01lwbpygbpb2cpzypaizw/mvqvov4lsmpjyt2x5+si9s11ptsuuknbupjf2vdhb5a0fvlbfks/e6xdkmr8n7puijajdxwz7aqvy+jyqwipgildnyrvshnagyg2cm2t917w/grfkcty6coeold5gb7qwt10dw8lhlb13ldlxvutw9b+etmtttwh6uy437ngomi517npazcczsz79wna6gtdkhssepmgzwbi62zzb6fx5rqvnwts/j8/yupke0sekaul7x06es1tbwn8ogcw4fhstnn22f63w4tqfzcet2323xsmu7crugtmyp8+qnuc3wwoovovrplcoa0wa0pcnlbx5rdmhcwlrmlrmnkqqd+nira1woy3e5zqlodata/a2vhj9tc4ozvselxol2nwlsut8o442ridwchn7sjcnn23hgujkaejqzwnlad3swoe07wb3vy3vc+t4um5jyanfo97ujxvnvmwdsrutcclg3b5hvldoxciiactskahna3o9resrdsexitji1q+nkr8zgcvddbpg7wi5flfzeblselzzfmfy0sus0rnqijha6mi3rx5farkrjnfxlju43pn4behq2ijxsrzvrqc3ioyqobvbqras5gqjbsllcyplszfwwblzir5aqs1lktbj5vqwrilvswpcjwjhivshxy1uoanpkbiy5ctoasghbdachntm0ehs2hni8w06d22suainjji0pvjkmewznd3c8ckfympewqi5ezu3mppoo9lbxdiyom5koiga1nqzvyc7zaoxtv/jte3f/yvt2xrbpcnbnntpyoe5qjo0/f9ep8f2rnc1lq/hunmuzd2yvecznqd+wqhp5hh0apjo0c162+b4qaqozedyes92ps0cvbstpjfcwiqwrsocsnlyymh8i0d1negis+ntpy8pjbjnk2r1oos998b8ktveuegdqgwgyjfqspfq8ltvajux7roccyr3swx1i6gjayn+f4tqssd46op8arcwhzt0ltsoq17chg5ytelvk3l099+69hhsk9hdc0onqhozc/zxwdf7xnsmm4vpi2zbssityvclvpm7dbagemagtfg0wav1y9s5qte7oqowfckvvgvqylhqrwjlfe2nv0waae1zs9wjwqpe3k2yxx3e22f2dfdy9y1hrwir4gfjgmqxaxvod72eimguuclddp71xsd4lnkndqxehnqx2xa6fhubjxnmzlljmdjks95d1zkz+8+iy5fkbp0tc1+t1etbmnrzyzg6hyv7vdylj984oliumx+jejsjhfkxuyhzje5onx9g/rzunchufzzscds3zc4ozfukdcnv99rpzswtixrljs28lh4njsprw3vulbokqdv7bmzav0ts3ovgcpstykdrzhew15lxqaf0j42a2lighz75rrpfofzrqu44bwz1vultmprsb9qyiq4nv4blc2omkznzkyden7x/seb95ayolphrzvlkscrr3onxh7xotsxwtyeal+kcivmktm8lmte2+dszbidnwud84kj1nc9tfgzxxdsx88og3wyq0klnrcnvnzz9uan3rrxlqdnny8sfr9veae6ii0eywreqare/f/wbqaciiajwiivjz2uiiia5pjh8yqf6ex+8kwlm4x/gkn+nl/vcsjsnqnv8ayo+5fqlfapdevfusxzpkyyoayzoxma7p2jqbq06wc7lycyvsbwzhh5pzdjk+oypbdkwoielaanglnd3fbj0mx/l6x1vvhy2/m/b/alfgttj0rr8gy5vflp6nknbkkvbjav8aovavfhsjkhng+7+rzfzf1qxvdll/dtjfrtmaeh8zw8h+jonqqskeeaoy+yvc1ktomjsw6wjbytyj35hc9xmjbdu1ulc4thnlhyx2zfrzcaxab2a5lvnlvnhrqogz6sggvjt/srbppjaj39pckxt0tmyqdpa6el5w4yqmvmecdgt1fzcjmi4pqjby5zhstphulircvjvg3fxc4x8ll4s+beltohqckepghmn7ckr1nzac3dngcdbc2bf85ddwxcqeqzry8kcjillsnkdgye6d11gjgnxqdldcg4djhx1tg+ns8thy2jma2rrmgkc9mcewj1by3cj+zoli+u3juxv1qfafaghgcioxmxtjlnnrk22zhok8kgpal8vpvfkiw1pz3y4tcrqxzhoslfhwwjxsoi+fmt4yykhjztxvjy5/ysaxrwbhlnbofr6w8yfs8drsiwx4prg7kp7wtmz3hjnnvqo+4e5rehsw1csvv60m2kk8c0er6adkngmqlsuvlgyepnvzem4lwclrjzw1vz8naypmwb0bc833zo0soy8fbr+thaywvjjbkxkj2mmggewonngeiaptxq/rpsu9vwv7n0uloy3tiojy45gxtmujwgjswicr4nwuctgctikpyzio/lfzwpjy6nlqxgblyrywbicvuduy4xu3unn1j0a9dz1nqjf6dslpl8zmklqxfeggxmnw+np2vrp5ow2bsmnji6oaeza/5gynlzo+1z2kuof4nfc2wgfdusg6yna7na2zxdrtylnqafvdn+zplzjyxl/ilxxiumdnktlnvthhtjj6t+fuqhgbdyqmvpozo+0ik7xozm5t7qpi7wio7rzv/wbioeq0ta+gcls4xhg4mzpfqw6m5jpxw54vxcgfhkwsnpg0srbigwntorspudnn7rj40wz1zjbkcoy9rhfmf9fgys53nyh4j6pp0dt3qxkgletj1joo3ghhanfvzply2ltli5oi7e7c6ocojow8mytwuymkxn0l5a1x59pknxqlnmla9fzjjzhttdvmomnspwcaig5lwlxbjvzswn2ekopboec5z2zbsutu7mqqelxbwqowt18g8p2mi6iirmytlgl/ahr/ajx+ntnqzgl/ahr/ajx+ntnmlyefdc/rp/d6iiijpkheraberaberaberaberaberaberaberagrsupkdyaaaud0c2frhtbdx1ippg9/hwv+hgyxjq7u/csintyfdqfetslbr0est2v5tbexhjyxnnnnt9xsktqwyuubduh6rwz4hf1dbwn7e9q1lks3huojwxc0ik/uut4/wyqppbj3qwqbi4vdju0+aiimiheraberaberaauabjngnst9zkhgp8ylri2e2ddc/mflosrj7fhxmjjjcbmahyu1vcnut9wuucvcjipynrex2sfoy1rwzwnc+5sq1m3pibabiay/7z2u+pwk7f3m5lysvodieflqe/mvxz2uryprxcihj9yuuxe0srbbir+zy9vvtnaelwvblx5y3aadd5ljgqql36aed+azkcrlxa5rd27efjmqwski3qsaso8hfewn4xxatw6ojlg3s7cdm0nnvp7vufiv6lps0sv06imsoiikekciiam2kpazqp4pugcwtv8auqjogaygxkf3wjp4rejle8hc7xtlxafjwvdntrtjebp+0apvl2uejndg7mfpukkxbktwum2ie52rmmj3gue4d3lzdjvnlvl1anm+tj4by09kmpmte0j11ayh3ut3ctyjtpjhzvljmexmki9vxord4kzcgebxoljnubkug3btborumhbx+it84be0k80obe/lck4yob5ps6ccyaid+uakppnrnk4eii2i6g81zw/q2h7crtpov6h7loxnijbfincfm16wh7cesjz55perfapciiaciiaciiaciiaciiaciiaciiaciiaciiacykom7rwbew3j8pd3rhv6mmlha+w+sfdgpaubhxsbwowhgbss2wvmjupafqigsqg2c49leadb81vxnjbebjbszhciug4udwszcmqqst2jwljdw7wtyt7fotp09aawbulqgx3mkqkehtibym2z++g5la41w/jvw4fg1wyghzpjcl5rlhju4xtdoxtaxloyfo30a9ykc2jxqcbsj8pl7rndykdy9fesjsju1x5m7qckdsl4dtjbjqmo4epirfzdm/lyukoh03y8lyrvr3svh5mvgdmuxnoyw6woyl7hggeg4oxvs0ftnxoru8ma7c2cdohyob1xozel9lvgj6mjdb+ywproakymataya+4ybeew7rrykan/wxfjvqdftzcjr3m4kmknmvyinf2v8ly381tapgyqkboqmpzwo3j6e8l2hshfnlf/pwf/k6qa0c9ha+pusuptfcwv6fqkkfrsb/a5jw8e1mt29mc/lgjri3cp5shisfgmixafss7jjtnhwjfl8cbsdf2veeji6hpbktjzdeo4ajjrpyifgmjyzrrzkmljc7tsmrs1xu0g81kwbnu8tba7x+attjwadugdnikdzh5xkynue/g7ktxuclzgmecrmqcx13xswyob0drzud0t3zj2fqlruvv0uxg+dvkzxeofu9bchgy/kczmyrwdbqc3nsua0mftyuljp80sbdnfylrjadyhm+c6zx8iwygfkkto8ntmicwg/pn2kx8i4m+tpztrjhnkrlpdb5i3nwknxgntat9yakn3yzr1ljxx5tpktypddw0rzcwufbldy2ancyqd1d053uw4f4mdraxzu73aoidsxsndwgbft/amffo15oyytpl5xode5vosphehgsinali4yztjm06xadyhck2nwprnow8essta1nprw2mlhrs/2us9ljrkefj3u0jynafrmwe0x69bqqmn4timldh6oosmjrweongvhczvkio3mzuio4dy42wocfrt08vz7baucnz3vdzhwjyxbh2dyv0cdrty1kblh5i7nqe6fennnyxv+/oddxtbiahnzymgw+y5bb1+odyxkojmdfllla7m11y1u5brstzxq+ca6awfxly4mdrqvebuc3x6q7jnc1nvou45jgl5moga3vzeysukzovnmnt8x17axvkcqu4ru+m7hhrlcye0genrpuxy/r772bfvvjxml4dlspaky2ctkc0g5hfcjksajgjydsxtdvk/ilwlkm4bpy5mltlsq4mt0+gdz4eqwnty2tolbc4ndiq4n/na7mt8sddkbktbrsdq4nngmvlchz65ybtllheuytqslyexhwpx3fxtxkixkdoxmn9rysri5pchtngexkxbspmui7psfr8ffsrrdtizhmzn22og5x3gwprawxikpelgbkpzab8vghpjj1cd3o1j8yvdp27j94yq96p7qtz++xs1iuhq9jytyaxj2av8fxl8ntx96t5kcr4ngon41qnvyaqge3i7brlxllegmo0pvefqti7bzy35x8atls8pzsndga0ool+nvzvd9e57y7lzguhp0ufzqpdhgggacwgwvarxcxijdtrrtwqxbh4+e4go8ssd3ehgosw8v4w9xsizc73d3besl6pcf/srqvnpos7k0poomhk6iikzfpc9tjyuiox3rglv1rtrhic3m13j0brx8i1q7ixby4sphvmetead42+kbyv2jc6npkjlulhrhvf5rgmlyabck2ahxoq2ys08lu9g9ts0fxxyjmppngzphsdlagnlq59w3uubtrdqkfhw5bhqwmr5bbnkoz50tvytp3uut18conyvjpz49pz3ecwfs9hmjbgw6onibl8vtlzxj+fagt7sjjz4z3mvyrdzeuvdkp8dp4xztowafuygf1jvqsycnbg0my0na3qngwux23tttxzlh9loo260st91z/mqz0fsma2wn2vsoffsymsuxqeo2wxrxbuixd9sbx0z+2zw/knb0b7fuqiiiztndg3pgdaua5gdy8voky9xwqnjibiphf8ts5t2ud/jnpnra1um5+aesz0nroxp8tny9u/f8cm/oawjgvfo07nasw+wlyloiywz+a4lykn6ebvutci3subojchzrsda2gwaq7zfjbywvwere0kciiaciiacpc0g4iudor9iqragooohaeeshkitm4pex3ef+gb23wd8hjud2llgwbyjbosle5yk3lsjjshfysr5zusrhwylocdu0gee5xetsqjjuckivc804jcbllzkb8grscu8fr9lnpaa0jslsatyt5m3vt5eekefzui08sp1bchug46us90tzi7uda4ah5itfkhc/thjiofzxtinmji5th2mv2a36ipm6hdovswtlg7i0uggeqmwhqfwv7sqesm7+wacaw38fi5lnwdwtborj7cmu1pkfgvwjvmuzpzi2wtasyzg0opjm5rtxwuxpcialusanr+h2cpfp3cix7bxijnbv6lgmx4emn9thqrs3eebjmzpzao0yghwc8hpapk/pzfpq7pnzyc9lp1ym1ozloilza9yciiaot4x/gkn+nl/vcsjspeugqp8072092vmkc12eixaxmxtmwn+9ss/m3/kh/zktj6pqvrzu4p1i8l+8v1j/wchwl/wdrfzdop/afcr+qq/rpirhnryhkadq2pja8i2p19xzgue/vurp5t/5if8yfvurp5t/wcsh/mrulrrpwum/hjj3vnaxeq8pxef4mng69xr/wcrfpwj9wxjhyjh6qqhm1zjoyzy7nmuni88l/6y9pzyieiqoz5gxh5b78uvszooyhe8rgv9rgob+9ss/m3/ajif8yfvurp5t/5if8yfdblbvkjwdm5sca8unt8pca7d85/dhxo2w0czmsmsulaxtnc2lw0oc25yxjll2ngxxv8auol//np4/wdti5/+9ss/m3/kh/zj+9ss/m3/ajif8yfk7txtw88kfdp1tt1t3mhqpunxfyz32l/18ye8ry22jx5kz79mio2skakmdgqxw520pswfxnwlfiuvyymxkicrro1jtizroaecdpogix6lmf71kz+bf+sh/mn71kz+bf8akh/zjv2lpkkspvppbkrshtdodg6jgcy6g/vakl7g/wayd+iml7ktxgloh9k0x9o31xzzrzh4g11d4f/17i//apwf/wb8xc//ahqvn82/8kp+zp3qvn82/wdjd/msruvfrwohnkfwtbarktj3ec1iqpbbhf72+fly2hfnyycxqjglmgsbmb1lxnihwxruicfpsbigmp65jji2kwnnhkdsyrl7tit9e+hxkf3qvn82/wdjd/mt96lz/nv/acq/5kkbhlumsp9h9ehbtvkvo4jgdnyusp5wmpkz+zkef8e+r45sqduyfk2r3asfm3njjputhxnjlaphop3gljyo2ywfzkdewk252zx9ig371kz+bf8akh/zj+9ss/m3/kh/zivxiomk75cdc1qvvfq3ex/d8nrkwc5y+duemfe7nita2ocjspx+bkdmtjidhbigabh+uk+r2puhjon6ionuwvfcysdcxjg1ebymnyluyts0w0lnd2le/epwfzb/amkp+zp3qvn82/8ajd/ms1rnxfj89vkn6dbwlppv41nplc2ipfgsex5e3uavfuv3qvn82/8ajd/mt96lz/nv/jd/ajlvnv7fa/7wp/7l9tccbf71/war/gpmo1wlhu0hb9rhkz9nl7zhxtmvsdnwpkmpk4brfsns8nkdtw263xcciiqzaiigaiigaiigailfr8qjgyxyoygbdm7wa5p0yutxhkrtjzzll1c2rvspjcinrixftqpfbxjfh7ataz0gth13tsehoryhyv+ptqjw7kzuo9kdarcwj9idqcluy8elw6jz3uw4d4nbvhk5oy61wqrbyakjqwnsczyphcrkb9f6w29ux+4rxu2se4vtdyg2vy3t9iprag/zwt0oa3duphyhnxojczci3d76rtp4gc1rancg1mujas0xttnblcpvqseauvdo2wmzsb867at2lee33rvxhhj5hfegkraqllnhscojmiay91u+l9qvinedgtmzd44itent9s67ssepwrfxxdqsm55kg3ksl8rr2k18xjppejse05osb8itviwfa3fg0c2panj5dfq4sgs5ng3znh1vzwzhvbxvnngnrazimad0yiitjilbkoyduu+b6lxlfnbwlpzzjjnzqretbwreqavtgxia5mw96pwrsal2m4y9w9jd9yfcoqsj5jzpcbod8qn+vvgyccm+phtywhsw6hcsadqw5y0wzothvb3pndkw9xt80htoenhzw4mqy3plwysun2hwwvdn4xejsku/jp5ud6d4/gga9qb8qtsfrxfmzgsw+i0fbt+cmgaq3oryveepjzyxjkmtmict8euvq5hd866wpvrk11zbuoubo06/hkp1pbcjf4rz4pec4gwwh3c0topucszeru6ahnbyzgis0+iimebd2an5j5zdx710wqkuvn2mmokdcoie4ctba/cpwjqp93pjrt8jyxweiilmlireqareqabv1lq8bpcpavarkm1wjg2fjidr2e8ko0zhxkeqpzlys699crr30pgfgryrr44oy+wrrgeo5x627thz2puv62qux8n/ay0ovpy2j58w02vmdmczh6zdhelevs/gygzvsttmoqz3w+fpb3kv/wcsiaqwh3i3tx2kw6e5rdq2vsc4zkuwmoulasbafs3c45blt5o5raqvlhi7jgva3lsd7+izz0zwejifgczcmuoikieereaereaereaereaereaereaereaereaereay2o4wjowxj11lrzidpc+xemfr23fdplz3wddntz1x7l+1bokk+bmtzbfa/s/jxrstkcs5ljtl6c/ramp4kbfpgz7gsweqkaiw2q2zdluwh/apxjonnp4qyupjupkno2ga5tp3vdda2lawnbyhlc5inbx62utpigi4r2ja0aotzty6k/zx0tzldfdqh8sgipd88f+j1wda1wdb2k4vfjvla2iauju45wmbq5zujrzktlrvc3mpfrpmxhy9kt5bg97czwpunomba/twwbstncrknsnweol0sdgiigaiigaiigc294g/vuoxnhis/siagufnk1kwzds42a943oy8464lfagwqvyysdm+qwu1nqek5g7w99bm5877lavpz61rl8dn+qduvoxhqwfp9etjijh+nmjht1lbkxgf8jcrbj+y7l5kp4q2iecrqpk7nxth2v8vil9vrzv3j7mxsn353tef0x/nznyakxcj4htvjkkojka1j29mbiczrl17u3lorks0awjt481yzkhg5um0oxtednwsvhpgqeairw5mdildjibvder8qsfh8mzp+wu81p6yhnfe7xgbscl6lvyrwfltfs2hypdmtlzgfzb2+kcdd5kovpeksoaezs5cmrqig4mrdssjnneapqokctdj7d88+3jqvrx0qfhxecsxdxdxxh9mjbr8skqzxsyhv2zetb9fqttb+zz6q1gfkswo0kslgwiuunqlyzqncujmenyxg7mdx7udxst8vyvhrgpk0ojp5otuydxt84bdhgxkkrrnmma8mhelttpzwhc0xcbxwdfy3squkm/wwxg+k8yljeyootkmuz1hqddvgotjk55zpexuo7nfuoivm5kkkexf2z5s49l6d4lxov6ntuipdzir1nvm32kgft8fqhg+ztgp9c6er0j5lvtcvbqjrusmkcnfqsj62wmiy1wmyapvclenyuuxspzlkxxsyg7k6zj1i5laaxxq1qqpkdzkuvbh1fpwkhlxocunasdpir1rog2/gqe2qpflrrqnodt1dpqn0jggt0jsxch4lv08qc9jts5wb/ypptuzy25wnspr8svdvq6eczqt/e54pkkletgsgohpqeqpr6srsc4uanu7fmeqawuodiejjvaubs14dwu2db7qtcouw5frt8kcs9xtmbjnn5jzxwd6sbv1rclvvs54auxadqdakcgcltchdqcce2uttysu4kedospy7g5kljkdxfggv/zasdx1h1wbg+edghzncrzjpk4hpl+istuiv1jookaqefpx3kqlecqrewmciiapcvaogsqkqareqareqareqareqareqareqarlpdabfyqalkbxpe8nawxc47akh0xpdifk5rouyiahetudqbbantufnsqozmm4rgr1rqlsajowg+cb3radaq6scyzva+gjxdaegunactvxpmthli0dwveaiplh67g5pseh8ukonpa+famo6uf7flzmmcuscgatydtafaux8rcxvhynum+tpgdoicq8nxu9coiv4z6rjhktpmdk2/8adps57h1ddgonioiyvehklilya0uaa29uzc1lozlf6qirzvu+qqnhrqk857cfmnogekzgjaqin9o2wmjqch+nuxjfztfzft6lecfiuy9zukszxyjwiivnd08iiiaiiiaii0pe3e8dgwakgarrjff009d45c6kp05vjayjzzuvlmdi+nq0rc+aqn3ysgr3m2zw81y7gpstuyeig1nhy0dpd+kexsucxfgxzpc+r2z7itnpn6o8ogwllctvz5rbt7gfnzluzpqxepcbikdonqwhwrkib1f/dcfxhxpvkd/s33vmvfqi+x6kk8uv/rdeaka87ahw9epjfihy/m6fw/6rpbiwvtxix2zwacog8vnqxjojkcgiostp3gql9lr58d1finiprec+fvvallsm88e4mhxnfyppr8a/aci4ng3hntd3gzzmaaslu8ew8vyp9gvhcuxa2szc57yxlqgzypvj5ftwdvskkn47r8s1c4i9nss5f6vfqlareqareqareqareqareqareqareqareqbzrk1klhssosxguepp0r5rjpevez6mrzrkn+awxytbfqakzekbebcoah5udw6upx2wxldre63rkgoq1plmbcvhkwoykcx5m6olr87ldyvw3pu6sinvpcvz1w9g9hsrnbm7vnoaovvt5lwjv4remiwtqkt8ehinuentwfr1zmewdbxfx3nopzvejqxghmem3hutbu8hsank121xf6imk4hlye7sollev4k4pv8akjn5mk91xucp6gqeelg+hzqezocdcg+u2+67bhtv2ktxdagk+zdz99rx8yjjbya9vmuiiswtfylcaqhea7t1sfmkm68rlkd1eiiqdz0ffsx58gpplwj6lcrutooot/hdrnzy6uzyhxbyjwjav2/ufwk9wgn0bkwmoaqrchcfrqvpozdp6p2+4lsdjlj1tkhtiox28d1cs3ffvi+0jhpsykirk0rys0jufi4vtyzttwy2eregowzwkhnidlgmoblodn/atytnhlibmql3a1nvenb7ip7zzqxi6n3wzddhoigcxwtmfisrzbfrczx9lkxozybvxwpdria8h9poquu4vogtglhbrrmsoxehk4i/n9xnatatuthttfsjv3ibw1jkglyzuipjojhuawydwcpypc+qaf1gbbe2a8lgm4ibnndboyczn7a9aoazcdonzqrljnmdcczw21ufwkrejll/wsywy8ny6aq5kicmjoznwlrea57qqybhdtbi0yvyqo5ble4izmaaeechuhcoxkbfdvrpgt22czbm06h3lp3dle6npdpu2j2ewtybelrofyptnrbtrpxtyrjuhdniepbaad5xb/rtb4hzizk9wzy23e8l7toujaegssnub2qpzwuwyjfpzfciikktberaberabesyudx4vjmvkwvkdb6lb6zj0axj+iujjks3cbrg/kobfkpzyez13tijenvm0khd+tbyxj8whqgekjdtnyanbp+0rolw0jswx94zktzzefweul19w1l4jacps3wn23uexwu1piefrxmkodzuffz1uh+9xsnxiwnla5krmohmxsfajmtmjzt+pjx3s3gvlbr5joqwd64d4gjq4wqbsna7wlofpn6hblccwffpkdzxsewkhqi3tyjmf2th3h21cdxpiywkz7pwa6levlpw/xjx9c/qr6vvlyblerzxaciiaciiaciiaciiaciiaciiaciiaciiacyyqk6au29v/meb6hyyj8judyhgsm4zibaqhc9inj4gqnizfxqsw6vpjae5zowsa/ujq+9a1kxatupousr5gclkcwml5nqoldi0zrrmouuouazus3+k1vurya+bi9auo2smnh7b/fgw4e4yfvofnp2xrxmc+wfmcrrfqx/gy0neumydphwrseri8dm2sxdzbvtmz08so1x4y6rjyy2cgbm0lljmesh+cfna1zybxnwnaog6bdnts0p6sy9noxx1fqs5u/dzl/4un/8al8s7uvkkhjklfisb3csdfsv2nxeem3zvsto18526wwgivaitywzsqzt1zefedm4d42dm3jixokjf3ovypz1aor6qawtb7q5puhc4k4ddo5jg5hs5uocup8m8rb7oothihsrzw54gukeswnmfjxlooetdg6fpxu3u/h1xv5+zmexgk9wadaereaf4v6iaoecf8pojnw15ce5g6hlftqdz3xpxnijbbbg7tch2hfqzbdabhogyksd9uv49wzlg8ehifpwt/wcglca28zb6h0bxpopseh5efxokkfejeqhdpy7oe7+9mnsrmdk3putnxhwe6jjepqbi0vy5q0ti6elsbgvh45mvj3r96plffelna5ud1dorv1wpzotp7fmzvtrwtru0nhdc+59ybymucooikhue8ccgp7v0wkjzcxrkd65gzvaxu2ry8ksojql5opq21orkmprljwch4nwx5no4afk5sxx+/vpwsyuo8t8ptqmn/kdm+pvj3ep5ohnc3q6f8mjo5g2c3ml5sortzwtbv1ugk3uc1e2bo1w0vvfbqxzmejm3yulbixyki46ec1jsv5ilkqw2zdafdavtgv5qjzpff1gv1ovtqvncyywkk2q60khqubrslrfp4c82g/jznzh7ojbug6gtye9ldfkuehpa3ticmtunpmdbrormiemsmjjzow/xoq8p+t7c5gj6jzz2nezqtp0tf4rfty5doetc51ruudzo5nxwkstlhfqtndbkje3looqsolyxaepj6u+tfwshzguvow3+ciwj1lpxa5banixo3ou5c2rllyxsculmg+q46k9b9fypshmerhoasdnlr39nmmu0ottk1zyqjrsftmjd6cn4eyrkjjhzp7qnpyhjbimpgrgnywna5bxwf6ozsblukaj7wiimkgreqareqareqareqareqareqareqareqavmedsbxpe4ma0xc5xsafexnenz6ud4pxa4mbzmhzdxka+e52w8llrpejltnbvu7nwkerdb7l2mni/pbndifk5bhe02axndnp8azj0wtn43rxi3ygm1venoafinmtayybctiaoxw/rdfst+frss2ijjknulmtbc2s/a3+lcxtvmqikyzkleu1zfw+ddb7hhgsksnqwdjyoigotzyc8cvjq7cwtm9oh+qzwzveu24hievpgzjhinjbc9ufiwvo7m6kvkkszntpljxmncxdzp8/zou8wynm6oka7pewoyinsl2blto6nj1udbnilmxnynbe9spas3eq4zzpkkecxejo1ofxynlgq/rpqmesgndvxuqylnkywiipisereatheretnsoreqareqbjv9cycosv5s2nuy7a+a89aub4xit6mewd7txnqfrzyaoll0d0n4qr2fodyg8z/e7mhju74dfy2x4fbnt6cjdw+x9dpuamqwnylcpgut+n7fs1vjr0xuqdvezsk+qdfo/cvomrgu1xma29zv2qjsbenu8plpzz1m14cgvywny9yekzfkhcccul7bw622puka2kkzspgtonjsfzt4k02i3juiloggnifwdvo2pwnkhalrdqfi3xsksyri0y4fa9jvqffbddqwtzmjawydk5r7lu/rdofg11rct9bc/wabvxviitvff281ino58dyhjjthsj+0dgsgzxjjzfqog4i8fbshcs9hujnta3isy5u64abitcn+dqquprn76kovmrh7mjbz1r37beruiciiiaiiiaiiiaiiiaiiiaiiiaiibahlpsprvo8gr28sg1c1nb/dfyuaxvkzq7z6erecfuxfwsjtzzmxspxfzdhzh8whurrhfctac7lbo99uvpdb7qnuljuihsgtbb8znwvcwrna1kyaaladzbhlm0d1bx6lkb+ncsejg2mtfvsztoohkk/c3hnxnm2kqw7s2u0e7l2b/ohjqxo6d2yxkpkt4jtpsncnrfwwmqckby9zyckm87gtc47nbpw5llol+lsqpe2pdx5gm3aoufbzolr1cckq4mj4/waamxyzgd1ziw+hoxuv4rll6nrz859gpan2vzved18onunva8dlpgdi0equ1467efzgcu/z0slbwgz9veagx+brcrtbtmijlvvyjnrewixqiigaiigasmhqjg8o5bohvqxktoycxlcnzwgtjrh7dqd4w3v7dancp88duczt/v5fatngvu05qcvlzkmlh4ndinfnb6j1xfyvhxmijbfinwpo8xwjxoiuc4dufedfuu7futceswluxszsoilllqw0wkucunlbh9rhorsffatxijsxzxddpbhv2ulkeiaknmsxajnxvabobneyh+i428umctg11txwuw+q5rf4jkhzxduezgueatcuiysbkvriynyoahta6+hprak3kc8ildkmnricmlc0tdirl/ta+5l/am9p5pxv4yx7gtsubm7oxdm19un5t1exhhcpdiwneg5oyfhbkovitzqzjnzu8zyxu4touejkr02uxzjomt00yw4nurs2iblcnhmo4pnzuyw6hkdxb/nxgsixr7pgymuwfhzctl6ehdgwdg8xjfowtlvzbzooyslhle7i3hk4lomxzz5anicw93/tycya6smry8i3idw8tzwmsqq05tx4yjbnrsyreuy4iiiaiiialvcs14gpj3k2l29kz9jw5ezmtqubekvgbmonabcm53+lynrex1q3zu9dves3ia89mcbvntfn4w5b8lk4tw7jukafrpb77racg8ksvr85banp1cet/iuw4vw9hea0c9vjatxcoo0sk2t4swqfyixhvo0gi75c4kbrpf6kkcjr0g67lotnsghotggdoqchulu5fmtgntfhd6z0xaepc22j+orbqfr+5kbtndxudfarvcrg66lvvnm1wisklopf85hxdoxmt5kmilo6d2kgj2qsce4kyqqk7u7keycnoz0+nlt+oecjg59rhj3xg7ozyd1bujw15znesfved/3ltjonwm8mzvpulpb4h0oqvf4x1wd1apwxq5prdneiijbqiigaiigaiigaiigaiigaiigaiigaiigaq+n/4ph/9b9ukhv8b/xtd/636ow56p8a9ujd9if6kxw+qiiiiu8pngiigasypfjwdlleqycezdrcnj1yeowgrc77neejsfgmtsxusunlulhlndsexltoyno7r3mblev7fn6ral5yix2qy0nbx1lgg5gxs0rwg9ql6k/++qv/apu1b/8asz/5lw8uoqbyonunp0quffkvwofcz6grc19e3eulrhuwz1ek0ktmyskle57+zclzcxn7at/7l0pw6drtipi5+9tjwtevgfkclwr534o4zqpkupddiftfejcykokawnmrugiadztf2qovxvjjss9l6xuv5yjbpyww3+/3g+iuxy/++qv/apu1b/8asz/5lieeemk9sstp5qu0rc5k8ksoa0phea0nfud2plg6vwagluy91d0eqwvto4nnnrwwknk7xj2f/kyxx3acrdjiaqhctfy4wwysmpmrsubc0upd1af9gvewpfvlmqf2boneq6n4sq7qpbbrxnkuyum/m5afonosrx5xj4hqtystbu4n8yaoh6sscds0ljhi6owz7yy5getc3m5wi1gjt7wufvonvmuxtk2oly+r2k0r7evzoqvw6jtlpaok6f0gte0xvhjlfcz3pp2asidxodlgwt1cczsbzqfivfwveud2niaxuyocahofrxa6liz8und61vm6/wr5+1de4qx2lqagckoamsf4czhfw5yudvll8vpzxcj1mjppjs696p3fpba5zjpe3fnt9dsnv5ipliyve3mhzxfuybhxb5qtq6f7nn6wgxmk4xc1xde5xlmbuygcrwdwypaazbaxtd8un7wegqmimrawmr5bgcaex2wg+rw16nl5wd9h0hruh4/ixxp1yw/lj1fqvbwwq81ajooixwk6aopjpgmubliwjpbobhunpqu5+q+chtbxvvy3vuuyd8yl8mpk41ptkzljqnkm9pl9h1xtprs+viqo0orfexl9y5+edu02jgxijjdbkglztxewlcu08bgbpc1umojf9tyvlt8znes9zv0isvyp3n9wrzf0sqs19si9tp4/5htr9djrd11n/g2/9x9l02hh8hflaib7rfpek3lwabadysfw/wbh3fde+sp6c1b5onkh7jvylmbpn2upegw5qb+lxejyaon0m8kljunazinujdlyo0ude2gu6ulodnjgyknqp293g1clmw+v+fyj3zer5f8a31v//wb2rf8a9mo/zlr/akj8qmnpj3tves7m1jafm98jgoyz3qsdt/euyjdkplskw+o+j9szoutkaa2wf7tokkeekzh6ijpyn08vzpfoiy/kx/d7nxtygjkfycxjrexb4nop0xbn1wrvuo05awhnt+gv7yl40zrs43znb4fmfsyl5gpflef/apq1nsqjx7hmvcff+in1gkvz/smlf8cvf9vj5m0p9uq3+0j8mftil5/wz0qyhcrnlzutgmwzjqbed22n/o66nwrx5tv4dqexnhruzyct4xu+cpj4kelcwqpc5mq/6hdwcdc0nhzw+pfwywoipc4axjsbqsvymcqrcz4n9lmujdhrsbuyn0nq4/kafzqnx+8dxk5rifg1fux7svldt/s4j2tldcg2v7vuqxlooy3ogs/ru7uepsxbe3n5frg+lkxyzjk5xu57nhq4kn3q7t18sduznlji2mb3m58idoof7q/3fx/ynn+iesbvd/8ah/8asfvylkhow4nrqipddluunibe55mveedcawfvz5lz/pdxwed5f2nvnbn7xoyzjis1stsxb13ksq5i6fiymv9gqrvvzusy989ug/yooivl/wdfvx//ahat/wd2aj/mu5+jirklw6nflk+v5dmdli5z3m0zrxcdsm0bpvzauitqfqqljsvwu08vg3x/qlqiitgeerfoneveta2srgsxkry1trk1rgtzna1oebbrq6wgigr11ssbrqdl6xo/nkmzjywdz6lvba3t7v8xfvqr/wd7tw//alnr/mt99nf/apda3/8azn/zkv8ab4+rs/6o1v8aar+ton8tymlpxyrx5rhxsnknhcnqd7fclhdi9rlcz5zpke7m+ptzmrnx9zzb2jvugrkzn/kvpeghc7rtutw165tjigh7vz8zmuo/6pbmsdfxo7ry9n2jxbfozklkobhsn/suh4t4k+vpy1jndkxobbyfjzdbwubbi8ceapsuilsjkam+3b5ncvkfovopd5+b6vf6ilid0uub2t1a+wifbeijaberae4rexk57kereaereach9j4jrgxogp2ef23fcoktfqd8dv0d0md/aeumluhpmjn5pdsfafag3ut9i/doultv5ufczvx77m7ccomz2sg7uuw8sug0fagsbuebth71huccbk0ltydr+a7bfinosp3deuzyro2lgoju0r6n4dzlf3ent/csulg6njxbouxescba9+xrsqmqg+kzbg06jmq3iza5jxgkfbyhgefnsbaxuhdnftx4bruxhid2yiigwurbmu+yuzt80fa2aac+n1j32mcuiqvofj87vodsx6gn1virxvhi3au5yxtsiiyrnfela1rbgwi6k1b3jm8miulfri5xkfr88fk4gwnfq359le1dtxjvrpsb9q5/knmfzowhx+c6yqvumves9hhar1cherzpzciiaciiacl1ynvi0mxrsd2wpstlfvgrtlkzuwgdxdtg6upww1ocsimf45a7q3tmpmj0qu4rlqimnwzsiijhberabxaamuexo5ua+o6tk7tzfj2uguu3t9idhgvkr8bgn41w2owopzgwmsm0yebuys25poyk2mwuccg720ul623veh04fq5xahcrudjybtf1vn2beb9vsytlertxjjy8jjwkcntkg857xtc5cczo5b1abvunvv8adqcsdh2bnesywpjjn3hozhbykfdhnpyzqwtpnzae7xodwnfr+salhxa6bnyudllnocd2ky/e1w7sywy4lhqrpy2buamoz3tmdheqefljo7mby6gtvrr4rqgjxgtalbhuyuwgqyahs2+z6ilg2pcl4jcrrh/grj0d0cjjxcwmezicztg2n2kb35lc1np2yijvcszyjt6r296kdnrty5uuwstbisl5x+hd+ciu21rw/mhjh1crymjerzryciiaciiaciqg3qnynf3ongaoppjkk28irvbssed3nj8y/waf2rdrv1xksv47baskc5ni4mrh3p6o5qm//i1wxx+vv/q2a9y2banofnkskk5rllzn0hmwponfyncfshmlcxs5wnc6mf535qe4bxhdutvg/xng7rw8r1u7kn0mhwwzxxgztr9yxlt6gbwlfa0+k1kxrinollcmtweueiikupm+mfmjczmzvd9hmatoybrmzzg6el7hc/rxucpgs2cusc1w3ab/alcrhe1aymn5bwzxu/npzd0i1wjby1q9q+gxs0s9jmil46lo7jg5x+kbv4latixg3v0yjdgy4wnm4env+bcwo8zgi/hgd103wsxhhgaeuhu+bgle93rwhuqnywt6acetjgwyvktlczbgoow7ltafitvw3u9rhupbua9rpza9/gfzsor3yulwm/n7vm+v+guk4fmkis1r3naiexc4jntioskpwrqy8kp3n+hvkv5dqltdae0v+psro0wuh4iljgaxujv23uvun4lkklov1mjvx0sgq1/qxw/xr5hpf61ue0gbdrcdhfyr0zg7sfr8rxztghrgiiak5dctbqkrtybvyqhxc90jzfni4357don0vribhmc8s8sdkvpvtuvuhmpvw/l7cuisp935dqh29ysux+s9zjr10tf9wkv+nfl/adg/63uf9m/mbgy9dt0pxwthe8n8pa2pomnivrz+jp5zbtxnhadho6txpqjy9f6ud5r5d16v02m1tfzjir7fxt0hk/l5bnfjydblh3lpzmfnrwdvmi/13xionjnurznojoaxatba2w9yi9hq2bc5nncfi361svx4cytpnfj4htvrnibtoanw7vkdw3j0xioesw+rul53nl3tyfktnew7rre0fplka0w6wq/sswt81n1quppknyluuypdzqkerawtlprrlh/jgt6pp+yd9e3+burziaiubdmjpw2r0txoa6n5n3lvyjwrxc73tap0h8bzwl4lxp5dmmflltoemu6g8weuebnw4hi57tocxb8nejqnxn5d3gcvlknrk6nxcgagoyz7gzdcovbcdmui9mrkwo0c1+u+d7lsgd4tsdojkaxmyzrc97ysonxdgzmyniynl+2c2zgho4vopo6sw7jftir3mzokzydzozeolldjp1vfvumv2cd25tkf29dbubxfhz+88lplcciiykereaereaereaereaereaereaereaereafxxv8axtd/aot+qfqrvhtbuuhjpm/uc3fr/wdqjd9if6kxw+qieiiu7pngiigaseup5kt9a/ushymjote/xfviobh6aun7gxonq8s7pq85rxzai0vcugpikghx6felxbqtd/8a6ffoovzje72wsi/u+k82syfudsooyz3eda+jpfowxgee2bub1o72i7fi1vvx0ovk2nndg9j2mzo3ne09cdch4l6mw2te0mmzfvmjzipitv8aatkwn6rict6ww2mrcsu6w/ev+v4gs4xxb5lq1uonncmsj/phant77+xfnc676z8vs2lpqfwjqjb4awzf3v8a7k5ngghmoqqaec/asta79g93h3aqg8lrqav2nt0boq3snwl/ey/gv238txvyqscleegjxvsphwvilojp3tdlcawrgdobeubqpctxj7bvdyoltmb/1xlc+jynzjxwxymzskbi1ztt6hp2kk2ajxjnzro9wtrdnq6exb/q6tiuczigkme8rplte1rm1lhbut4xw6gxex9ndlmqnnsx1q1oy36udffqs+uwxkzbg7m1gt3y3flxb1tbkqooooi8rq2knovyaaaakrozvducm8ghbue247cd/l2fmcc9mgkz6mgnbukepo7+kcdj7gt/tlnlg3ihvbhihezu1vtpe4llc5t/oxs0e4bwsjizst8lupu/asknd7tcqpm/w/6hq1wr/zpsjvo8in/+p/8a2zgrfcl1fnuyfntupmdpf8fqkulji9vr2nly+tvunr2ckb/ouf/ln9zs28nbxsz2eh9gj1kjhq3sjap78fkpvwpr/hy6i1x2qww3v5hxas8eic1xh+gm/ph/akyyf/dqf0sf64tef4ab+kf+smh/amnb/sx/rhcll+e/+l8z6ih/4cv/ac//ainxgql8xcqgmfj4nwc4flxjdrt8whkt+n1i6icrse87myxnya/yus1nq6r73un3pcxe+joy3uq3lpqui8v6hmvob0mf3covvwyw7ecnx8ufkwlk0whytoyxxl5522hmespoqv0sji27via+9dfwndi6enrgnaso8/mt1jwrzwbrvl4r2/pf6qlpsvcczulx5jeb/jesw/0xvcra+7gg7bfzp/xhv30kynl3dpr0xymbyray/o5hldbcr9gt0f/grsroispi5ohph1b4m5/dcx9dlnahcmtdvsy1qay0fzxobuhenujpspesj0vvzxustgnnaoas4beo7s/tuirk50ti7kad3wc/mqe+ks3ynuuvylnd0/k36p1w2vk3kknsuq1b7q9kc8cpfjhlf230mfxop/4s/wbyxcsxx/q3uar1dc62exut5xyn+kzbjzq/bnzeleswdz5r6md6z/4ntf8afd+6eujlr/pgri6gglirlqmxj5/knbe9cgrerfx5c+i8lkwwpn/u3uccogpyxitkgvykc9ht71ji/rg6vhdbwnc8dwf4acd00uh9fuerzumpcchcpca8b+o3t4qeydw/hc/ohuc62uxtb3k9stredbnp6shmdr631k36huhcsdnpznlzfi+aa+hkgkffkwsew2c0/woqqw3eh080u0zs+j4e32cj4hue1tl0uoz+6fm2zcbna2+ndxsfgxhvcgayakde2l2o7tkv2q2joa+8t17z6toaosxrst9wvjzg+rbf7vyl0o8aue99dtywjybvmjtbo/8akr9bz8fjtb90tq4nhidhwuubw3/lswnad7sf89pesssssss5x3j6q/d1moqk5fjyfo90ye6868t4wei+/wa/gvqelcyjwxu1htdcsbozhamhtvfceaoraqoean9evw5rjf6wpavo/d8ojgjbhfggnyaaaaosr21t4m74njrxw1zyp01mb39irykm9dc5f31bgn6lrf43vfx6hahojjqwp/nccpiu2ir32ol5hkr0kv8aods92ec89gxcc1gkp08ya97msby37gg49ppuwn9nn+4f87/autrknps/3d/nf4e2vtukdiv3utdkup3xvo1qnlz/ao1njf9cei3/afxtfpzf37l89r6e9fv+q6b9ob+/cqtj/m+h6g/6v/0cf+jfsrmkrwp5msaxpcgtbq5ziab4krwppgy6vl/in+pvv/ezf3hxc28cwmsxvnfpclgoprpk+jez5wxb8fqwyvvviw3bjpi9pnx3s8209qp9spzhgopht+htxtq1qqg87fmyvpfnexmynzua3m71rc2utygqyjckldigsdwdypbtm13awnd6zf0h9amvmcxx2nixtao/pe3ntdi6fruytlvzsn9nfss96xwo0rvpak28rpfbjm9hvb2amc2kihuslfkihnbdaghdzq9v5mwdh3rjr09i6fxdtuhqjie3dix2wutjjgyjct5kprvtui2+fn5fdhg9q9ouqpnbnlzxlsnns/caerfvhaheraberaberae4rexk57kereaerearfjjhqsrhy6gltjox91twlsi7w8dgfyumsu7moeyrpy9hs5jhzwd0prftcdgdgoojhnm1j9wuf9i3duewqamkzz4wcww18j27ee8yti1raiklikttq9dcmg9g+dz807hzre60dtbdsasrqisqx01ix5dz0h19luszebqw2hw2fi5ppvdut3jvx0cti1v5zna3j6nqoqk06jcixfnruykyhx2ea5amhcy+z9qzyvspjhpeee5lgszxjej+h82nmo9jvhd444u2orjfuszsl8lst7wte4om2607yoxm0mkske5rxtiedytiuc0+1pltio5cccqbnjro51lksgohoqx8nkl7iubz22pmhrxifikc2zdigu+dtcef+sh0xlsskmk9jnxantq6rrfmhqzi2hvt9o1zxtbsxninrnn0wdfhilctvyrkj3acxu/yt1r8knlj2w1dp43tgceinwbexwkngmjjz3iq1wcony2m70cywy4zjclbxynupw5kg+gnvu1vqjphfdaxpu1stcp+snrrdxvqu566rfwguo6y4ciiregrf6gdxytbxniblndywbjooshbacc7n4ec5tjxeb5mwdvx1kt0lwvr57enssomx4l41orwujhtt7aotljmj9bnxzwnj3ibm6oj00911t06mylckeputk3vjubjdzuh4tle4py8gjuwj91lglh17t/h7v6ggc1jhpybujo2d+kd+ynnyhd6tbb2+9+a6bqylho0ojfmhmcx4ecl8/zqdnfj7fjueeitbph2jj2d8r/i6xpw2io17gelmcwyencstxlg7kiag6g3b1bgxftwuwiaaresabkkr+9emggxuxf9fepvvza5w5tk18brfp6eh4rixwgse7zrohkvoukspu2m+ccuupo1vtjb5hfovlgmuxut4q3t41lcwgrndg0kkov2gf+r5rq4zhpkd2js/uou6jjyzo3pm5kv4xryc6oidtnfjkyhz3hnmtrc7fwyr1bljg3fhswsmt4oe8t7knzt+cxxb7aoaqwvesji4ktltxr65b+hrzvvgdegjniep0jagkx35brta8mlmsskkz3riqiknxv3b7kp04uo7brwl6epashrqsvd3ttsvoal93vpvx+tz1o/i18m1hkypzip/z9i1l1su55uyv3kfnllaciiokwreqareqbwxo7xc4mawznyhzrepug4p4rfjgy4w9lcxhk517vh0z1w34vxzkubyno9bvynhptrpxksrxuym522azkb0stm0oai6nyylvnqedgkcsbms5xokg17x9i8bhi4g0avtwir2pyt4d6ld1xxli1sk+eauzhbuhlz4di0sdi2v7hn2c2/vwplhsjdcsih0srn7hq6doavoleczroy8kcaxzhsu0we40axab+mlipppy2cnnb+duyxzxabfjmusy3te13rwpmc13dhtgjwwyhs/wao0tzxsuben12jpofeqv3qthle9go+5sf61pjaautsbf4bzmkecdu1qwmj+y273dwprxafeomemif3hec2jt0a+aobfpfzvabjhebkt31m1t08ytfktz11exjmsfi7mw5nnaay+bpvr/0gbslpg+fwiive5uni7hqvoimblz3hnpa3w3uotw1rlzdbivurbmxiohhrdg+iqfd+cvwx8zn7pr06lzms/u7ewg0pfc9w6+yv6mw6r+7hg0766nw8vnmpb/s05arnpicown43kpw1hc1pyudk82dhdx9nbx1slq7pjl2gomtadrcduyoaa82t5+zutng8dro8zr7z1vmnl7xonh9sy2gwhilqrowpwscr3b5fdncdt6rvvjzntfcrxc/vmlos/unjao56+azoimxsyt56upuq1loymek5bbunlf8t4yy3etqqpnm/wutxc06s9d/aq21pxuvvprb8cxb++qmda5vvv09i5oelzydsaff717hxrlpz5fuuqopq1po0wai9hqmn5o6wjuh9ixpqjxrrgm4mcsm4dvfuh87lcrymw65t+v3kzqv6nv4tw/au6/rq9hfgv7dkq5ybmb31f5df6j7d7frhjq519sfgqjknor6ipb20myinusb7d4qmcy4w8iopbgr12exoywprw6lzmn03381kmswds2hphnsv7jw1svidcuvsprj5v8dofr+x8stob4ufxmwjwhrkogc9uzscil7makvcb2tz3wdfigipjvbqmjahanjka25bb175rn5kt4k1j44dlbhyxta8awblbfvfydwgtvqbe/uuqk8zb5o0hhquxsqopikytmjajtcy9ndgzr3s03obs19lkofj5oyifcnqd9t7rir8ojjftydaoz8fn4ptgc2w1usglmu9lgmlkkp45i1wye8ypfibidhc2byb5k5dw40vej6nkkgaa2r9hzo2fha/mdvj6me97k31ddvkulqcg3fr7fcnuk45wrk6mply01pw8xl3mkjjnfybaz48/atbxjh7w1og1r/2bztyofvviu0/erovs4zvfsyi7splp/cnoy/n/oa5qtolvhkrj62s+zky27mea3cmp8lg/wbixvdk0zewbnz9fx3d3q0s6s/xwo9oreuioreqareqareqareqareqaryui4gycn0jzo3lolnodyxiejookmd5ax4ijgzyxh3l+5vq3tz1t1svmiqvow9516xeowuyoqi2u+i5zqfjziioonx1fvgv81pdids4nnck++/nzdfxduwkgoqljts0pox+yddt0vyxtntpecu/nh0wi4/h/pvqw2e0muwgmdt4nnxdud7gpfhpphpjigvzu7jp37fl/wbpl7vuqwvwhbpujo14sjmze52gp8rkrjh96tdz1zh/alqrnrogx3ejfyjbggtd3l7jzxvf781fhh6hx/7qtrodprvwewyvpa82c37vqieiilszzoiiialbxc/knebfrwctdjtvyyhvw+pvl+wlao/91/q2pr+nr6pbr/8a9ifvggxqcfp2z4hxrj+ep5vlgxnybpzdrohbc+w/wdzhc/k9zc+yd0kx0tqoa4vplt9oqsh/uv8ai9y9lup/2da0rjgcvi/st/i0c776ksr7xdo2e3npi+e+v8zfg8e5cci5dncuj+ivhbamsa46np/lqh6aob9zvuuntlw6uh7i116irqw109+jl47frmg9iejdvinub3be75ozwdryj+1nw69eof9pvvmi7tnhofz3ad4b3vxp5zs9znon3pcxopuk3j+k7x6kcj7ghehb3ql5lvzybn+av7uw6dstqfvg9ymrlpnhr8lbfn+gtjhejbvlap8a+knp/lp3rz+j2tlidefz3n98th9qwelgwrq0f/xeh97v2qvg6xlx0jjt/pdbfznvtus2q/h8zrqlxytecp8a4n03dq70k4gicpnofk+tlhfbqkk2cb/vlljmtr2wrsyubijaxzrufal584y4glq5qzhmw7zyrfiwhyaexblvongvtstvizzhpky1+ourzroxl+ymd3n34x8smrdydh67vjo/htwlwypmvebq3sr2ub5rc/juek1qngv4lz4wttm937vzk7h00sr696f9msoanks1bpeqt+7xfbdx+cz2uhzm2pmp/a1c2nfiolag9llsbh2a/lpza5rdsquqlw50nlp4b/eteiltew3tyw95dtogut08x5xdfnj4e8wspzwxm+ogr3mnln4latus4uqdzizz77ft/wakljsuosa3jw8zd+h70erekfl9i6lvpljov7pbr5zx8dm+ifw039i/9zmp/hof6vn64tef4ab+kf8arjqfwsp9kz9clkjfz3/xfme2w/8adl/5f/xohctsltjny2zzwn2uasuaro3flb0svgwh/uc5yr/wc+mvd+bob9asfyj+et/sjjub4q6plj8ymkedwpvxswvzpgeynqsd8+nwhmcdb4fdjv8abx+lpfz9vnnmembkupvpgmopd/1yb7bstecyimdhr1ze9zdru1ev5mu5jdt3k8vpksjbcoaxjx2be4xlug6bbzpnoorzgvsptcepp/oajndunempsasor6vckbfrxod3emoa3w30ha/bdvc516y/4jd/ams39ryq3vstps3nnodceb+k0u5w5dh9hmpbdk4btnv/anjdfzhdp9flf2zjmkkdts4kd8xul+sz+mtkvv5m7p0vtftmo86o/u89j1u6wgf5sg9vynuo7+tdpb2lmk6r6vmhmmelg/mw1gux9yfk3hxrsvypj1fp1tvjdvrjsxtlq51s+pn+d/sj+50l4fkpbh8hlz9t2e7qlwyhotrippmqhtigo46cntthvmzh4tgud3gqcugavnq0vhpnytbylzbwzdpifzrclmgnpyhxk7zgqpihmovwqxjhpyvt6z0+rxc5rtn39zvf3z/is1vu+v7pjhl73kufi43jd1jus4j4hlrzgypbjgy4eyeevy+q0c1eipc1wclxabi4dhfyoi+gpr9xxhwwfnztimgabjezrrhykyoq0onl2hotyrnu9z/5kpxrmtbwr8goz2b/amk44/psa/0uy5mpiynn1dgeeay42/7qugruppjijooj9cpat7woh2rhyw9/mjprjh2fy82dx9c1im1zkrqbhg09bqt9nuxx1yd0k1yzvsropbhk0dqcq762+9dfv+0x4sos9itx9otz7pogiirjibck9nn+4f8ao/wlra5j6bp9w/53+bvrv+uza9hv/ekfx+josl6e9fv+q6b9ob+/cvntfqnot/1xtfpzf37lssf5nw/q6n0r/o4/8s+kizk1nc17s17gva4wcxwbar0i5q6hwseecngujfkkbnqu9oc7hntklzndvx9rrnifzkon3v8a0nfwuy+kjd2nkimdmh0gypylam3z1xmf13/po+tl1esla02vpuahohbw6pcxepurgnts7fakusqpaqwyvarqchobhkryboggp0av9azp3im+iz+2fuwpbwtxwtdfnrvv/md71xrhtlgcy30lftzwyt7fbmssvkjixome5x3c57it5lzggzu7vgzuin7gknkqf3im+iz+0fuwvqybi17xodqg9he8ulvfavn0+9hxhkuxhnz3/wazlut+knqq9hwp0akxouwl6jty1tvpn0iiuypeaiigaiigaiigcciilyc9lciiaciiak2vasts3qkcmkan6lgruidrszmcx1jky2uxmcjbahnywxgkajultcmrh4dqvfk5aggwewg7x6aa8jyvqnpylhp1xflzdqbkmmctl5y25w36epvxs9cjb5bk/fdbcnigilcduibta3inwyqxhrxukt8jszjoyd1ty2whuyjli7tzphpy7bxjt4btereggnydurqivel8js4hy62tfdlnuk05lfkte6rxhsj2sdduwsb7fz2ywru07pma7m1jgc0m/mc106lf27wvpzqjho8jwq31x5jbpfdmi5rxilpqmpnngqbg9o2v857xoyspxjuruitcn57race4wiqhhzk90twe0ik3a7iduo1kldbtxyxh2vrtl5tprxuf0g7vxaadtsptvmnvnkauirujtjgwlywwg2zi22tkzb/uj+0lxxj33c4+p27fbw1mvjapnjedwiimchajilfvk8jcdzztgnppufufzl0h4shpbe03een9fn9ss2tlxkixyirt0xijiemokce9cn8xk09ruhyg/u+pruvuuuhqd3kzqroke0nbmjnguhsuuz2hj4m2hohygzgfxpjs3dpr5pjz0lmd4+5tthdhkrna5zqxo1ph4lofprttss2pdzk2ocgng1p00te7or1po6nhknz1wuqeaxtbbdvzhvdznkoiwkujaqdlkj1aixjio0ppej8zvfk6f5y4wiox47o2xuawi3u+47wuamrrdruvzuodz9xpzwjb1vfhnuz91q8kfsfb2jglhdpaynou+cwaezz4+x42utxdofsznpphipvjdjg9we6hdxikdg1w1dgcpkyyr+jonqxd+ppbz1rwyperxc74x4olfnhpmxdnjzgea+qn9vjv7e3lwlhcd2svkigss6h2jdlvylm2rmjw+yscr1lpchn8oab9i5bwzwvppkyaozrxrud+9cypiowhialpojkyul+e/wcxxju4uvpi85epapvvjyl1g/nex8ffba7mcogvmd61ez6+sf2ydtmfsadjinvrnid+nk6n5olcpqjzhc4kxbtubk52rd2rjetqh8blr03hdhczwlzutq0/e8li4tjj46arnecshyi4apmolur9il9wckmygup6c+rlquuamabtzod9j3n3wwkscj4ppknlavsm2vudjybg5+xutdy1vovloqo2uyx0rq6t1qlo9pi2vgva11uakt/wgrukshlvhvlqk8ymctyn1bsdrxvzkxajekapm11t+ua7kq0atvba6ip29sf3ulvuqvl78ki4vqpx961u/e1oy1mveetw33brzivikueumy7jp78obn3axyf3mbaeks0+nvg/w2rrqdyolag7/d5k6idhfzrvq3yaxtz3y+zwoczpozka8tuhblpgk9k23ih5xxh4cvkzhk5ryh1bacrfqx9udflflozo5ze2azqee+/1q79ipu1lll9pwpdqrvqihsl+rax/ehvt5jcblzylef9gfa4a4anrmarcde23kttr1oa0kny+9dw9gmylxptu7q+zqnv56yyrq28e5nvsbei4aia9w2llu6hhokp5opmppc0w2vwnueakxussujcesxfhggrhbja8rb61xpi7hcencxnic+mah7qtydcvo7eq2cbuaaozed6uyi7vbrd3exrqtgmyxyybvyro07yxny0jrkcq4j2ixknlmqu9axi+z4zid5es3w6rf4bi0lo9skuharuatq3oeqlng3aas+ro2knilpavwlxdqwj7fzihku2x5af+1cp1fnzjyvj03ful4z09mmgcbwo+45g+a3ogtblyxan8brm3d+ifpc29inw3+oqtx4pcehuvmdf1dnx8elvz3og6r07wanqfdzs8wqwpdprbcrvumfjcxhjyzlj5bnxvouces0eslbthrxszelsbsfx0vllssd1z7e8/isikmeaeizxikzmdqeqwsyc2udaozvpjqbc/b7lrcbqgxhgbvzb9nsi28s3vxvw9u429pv37l2k1hyo7q6v91cs0goys6aqxsu4a6dxxxdwjsbndmz22bggt4kx+jvhntp8asjgxzm7l9oq6hw8pslilmob5osnnoi4a4v5yqn8vud/b2nkeensuypmz8zbsqvyqb7kc8tciywpzgi5qfxbqzzvywogfatjb6zns3tudr1usk8wsiss5j7gldumh5lz0cmczsbo+b4nzwfjggxjvvp9xvlly3nrodzhi9qfjpdzrbd1xho28gklpyo0i0p3rzcs4v12wgrgb7rin2apcoy5o+kkhclk6dpb/ace/kdtftdnvnj+fn+4xeqwcasdwk45mmlp3oi02/h2kyyqxzzyjqjggw9mtldomija4r5g54alglxf9gpbtycgeezqw6309xcyos1lvryb2wxp9fxhufpvlf9dwyhmyq2nxvk0bhtkpv+6iawhcnqdx6km1whnly6prp3b0ph1cz4iywahtze7vn9njykg1ly25umlkvk5uhdvpgtjt5wxlfjurxxdaadzbda2awyzljpiyiyawzyzre31atyuypuhryxqy8hm0dpucreabk8ozopgk9c1d6iaykgdmy+o0u7wj5lwzaanc4c22ow/kwegjhmj5jansl2v4wurfhse0wlbc5kcrjaxxjcxkwjouu2yfkditxkjkf3c4rmvnelgm4avf7fjq9/mdqpwpkb0v+rlaby8+xgozjiji6vkchy5zhna8w3tp9sghh1h029o3jizx3jpx7tvgqfqmexl0kbw1adxt7pkag/rwg/mt42an1crvfrmlq3njwps9zzxmina9st66xgwgtmnyi0vqlkac5owv1slcwy6zjxhxs7lzrw3ig3tqvtc7mrth5pr0upo211erwfmlhfunsm86hnbchazckxletsopq9svrwkknk3wnhf2la6sz7mocnuq66rrcu4o6jp+1grszbm1173q28bfwirhqwrkqa5ksrpg4kxio5cpv8rkjky9hoz+sbe9r+p4xfrfgy6v0bidu+ahtntgoywmnsrmctqdsfd8badlozqbz2x4nox3pbroepswqx4l4/otfpfe3yqk/wdw+uysmnu9tefik/yodduk2dfv3ep2bxo2n91b/sk3838/8jefpndrbth5p9sz/k4/5znx+5eioz/ks96hgnkt1ff2bs4nzd6fbjzzl5/5cr9jb1vcjhf2p9savmiqqszyvulg76vf/yoa59ixppc55zs0mzo2mkvmpjk5lq0ljuyroqy4jzu43ygxxucf4ggpmgza959z7gpgsqpb29jvss+86+2lxqqtqtj98hkcylr6sb0xewjvsybdr4glqzuhylftjzjv7l9ltwdlrgnphswur4l4vhccq3kevgpf4p0lrssy2j3aqxd3ohnk1aiuvjyqeyvv4+qw7xbbhrunmkj6vrlvmyae9pb8bc1fjnsku6bg9zwvii3k8d7lpnhucq02vqdl+wlacbbc36vkrqw2mgyvjcbser1bc5faf33gkgyyvgzzu+hmqovzhfnguvoqo/1lgp8aw4/ucs2sxjxf74zm9xb+xzxu+qi8i9lcoxt+/ovf0zwgreqawrxw9xn6x2lalt447+dhmvn9velsfuoj9eya+s26/wb7pytzp1ich/gh+k761hljmkh5jvt+tc96pl+pj/7v5o9k/wbjksdopr86n0jl9ts4lflleor7w9v4kt09w6ptmpt2jde79akxhwc2woreo7+qfr+xaduurufcupjd9/n+2bvobeq86psct3fah/6epwwy/q0hmliib60r2xjzlrx+k+mpckok7szckaezwdnzuy4t6ksk7aubirdtmwyh9m6nhxd7l1/jkutoqgtvflykdcdvl0ylnd93gx/tk89bw4/3yt/fnztjny6aonlcahsyoeqnhc7bykbs9h2s5pv7d1drhar/n9ixwdltqpqupjdpp8gdpzn1+ku2+zul+mtsnb1c6c1vnno54nhpztese8bqqexjcjr33kk1vzxad4a2b+cl0jhxqmofqyjwytgat2ho2g5bqerx67uuzknf7pdr3bhef6orsu4zuqi3j6kx7hit+w3zpcv5m8hf2xlnwylni3s4hep49qkgyog+cj6d0inzs8scmt9i76uemtxpn4rwjcmsrtec7n5229mh8sh3/nd/zcimbgjopgotxwzjhjle48jr9qj6n0pwsfolbwcmn9fptgp1i4lqrqjfpzwm745595xhvr2c0buwazvi6faugtk5kug4xu9pfg7cltj5jq/urpqq2vkk/evo/wajl/0h2oj0rtd8wf1j/wdl5egr/wcfl/ph/rlyg/hyf6vn6wsv/hzf6r/6yup8lf/sm/wcxjfz3/xfmd9t/wddl/5f/watptdt9pfiz6tc34brlj2eegixbsr432xwwlq3irbi1xmy27xfwghi9ble6vaupbvi8r6hm/ot1eftxlbvxim8yfzsx6/or2jqnrsmkbuxwcpuxbufyo6+mstfly02kzpnzw9ujkufrnwzf56z/aqvd4x7fzdor0c3zw81jwl5khllhnd9d6bs6kozziceh2a8n+/m+po4w0aawafgfwug0fpirwi0kfpn+flfg4+dnw+crqptnwhrlltr+lhk8+y7wvv7bsox/wbwb5pgfjzzt+v4hb1zr0x/xgh/ailv929yno14zqayoqy6mysxibje0nywms6zg0aa+u3e+wwx6y/4jd/xlf7t6wpuvsg5iszs6lp1snrqyzlccbo4cu2ehgf6hu/8uf7li4mu2+hj+j1p/fo/umkjz/ztqvsb+gl719r6z/4ntf8afn/unris7b6z/wcj03/fn/unrislz+ahoz/qr97+p2x0o17ewmhojjmzgnkrlald3kb8s4dhv08st2c7mni+wu1/ihcw4ehcyi+uxtu6cqfmp5mrmhhndfoaosxxywtnadb7fquqadvf9mshddruj0+qvcpellk9x8qyxlrnniswulspehb4ksca418lrohudaoqmgx9f3m+rdt7ftx7hvyyhvnto9/bn8nak+8lrsg3swiv4dt3m9mko3lp7jx+qpojisrv9hvwrscr7wcruxbmdcah2l53it4w5fyv9aswrtrsuk1nkyckdrhlng67nq4+9ctx3d3ryocdq9xu786+ojwre2uuhjut0uv3x5neejhvvs9z2f16rk8xfzy7x9/l5/eucly+6hqop2jmg92wmfoiprd6ipebfsgg4nfuxmmhlekbxcoh1ecj4l5wwzwbigpo3f1puoiv6zbzzhfpmohvc3ufc2fb0nwuik+xug8tw2/dxt/u+o0xeab0y1yfn0tpj+co0yt4nvek3vemotdfjt00xjlke79a3wv77bs/aow/1zv84wvfk7kusemz/cp+d/gwx9h3hdpoqo1tu0vjla5rnbjdkclbrwgdm0+9az00vbghkagiug+hcrcs127muh+o7pnvk26vghnrvhoce2laotl6e9fv+q6b9ob+/cvntstcepk6lizdbunzgwulwmojx1dc6kxopkz7aqqc8you65yvb23vkljou9/c/y/m+kl4vnz/aou8u/nbp+jb/lt/aousu/nbp+jb/lv77dt8mcr/akqxnnd5v/ljr6rmza+rto0ame5px881vvc43p67/wbj31qzu2jcamdnntkmspe6wy+tkyiw023khs/rv/td+srfvjrlz0nhom9yj6g0alhrn3sqtouypphgz+ah9zv6q+ts1rbrrwptvzv7ss/shucj6r1gjawkqmd32l3pn6mxvv61kdtpxfnpu8cv3mksko/uxl9ie4j+7ev0h7gtj+37x/e+x+zxf/zx1fzp/wd7p/ljeiohfma09qd8fwttpkycjkli2n2ciiboreqareqboerf5oeyheraberabx6d3ra7zdvg+6xzp2rtl3ynja3v0jygta6k8lrkliagoukdxewpyuqsc1jydtgnypeqxqhjvv2q17+r3jywwuqm1wxc7c1jw1icphmrvtazvl7fjubtyhilfdnfpxgrfkas2ahvyc32pqthiekzxs9n/btaaagi409yibsindrnbm9jmnmidmsjafupq9cptg1dt1latuvppao/t1dyygm42fl1gvvt0oos9ppubitupmxyui4m5mvcxptvqb+1qphei45j3ny0ubguyfn23hvderece0jc2eb2ul2eadsq7vc14zw99e6jrm08rpnemjhzb9r7nxtdonrnw0jrru8+q9yr8g1abe+ppcnn2nwk3metgyvbdtmxhx5klyltujimhgx8nzw09gwzw+52aoedndipmnw3shxvamncefljjxslgt8zbeoikmqberaghilciynye7dtzsud4txgsvzi7vxjphquoekjeozp2ahv5ons/aunsjlrk7o5ddvs9pppr1fg4lmwc3l7r1yo63rvjruv0lgvaletpbvpg327qfwrevywd1naffdlo8o/itjenzanamjfwatrl6j99wxfrxcs2ffzc5divultc0bpnjdhu0uapt6lfuhjeblmy6+2vzsuoyhxbrwgskhcmvjzzkltulxusdwsddeaybxxyfsnyb9g1z+zbvqppymsw7h18qoyunmdwgx85qu9ottekrb6rfqqmugmiowuquw3kzlvm7+rkjgp8qpczgsqha1nrp0v5brslgs946mjz9xg8sya5zxnlb35jyxemxozhlltbwxtw4o592/vgzc+qyamfvkhbhqxiikvs4eurzg3mji/ue224u9rb06mm7mbdtjol7uailfort0966xwrx5g2axztfmh9qtaoyx2psy5lebbvtsgazz47q/vprqleudmhnxfqnrse9id3tliwzgufi/xntstjwvjg+qljnti09nm+mde3uuotpmqbxvenqwua9ri1zchncnleg9wfypvs9onnwprgrkastanlsfqzgafgfizbalv8i8xxvr2qbjxuzc57qawaduhy3lxgq46ldquzqe5su6qlwareinnbtxsvrm4fg46xjxwhwukgjzajfwv35ig6mwtutbzrjpst6lg1+gyq1tyg5rv4+9qj0h440vztruuiznlttm5nw34o4/zbekab8m2ybdxaxkzjy9znod3nel19733utgztw5a5gfd3cxormsqzc62w6wxg3cvmzxdl9s5pxzrfn4/uqoqixu03cnrzwvldgpvpkcwjpt+njggrzpsoacgnf7bxozr7ssoi/ifzn6ou0uzencuvvda1okn1ja0dm45b+icrp4aw3ba9w5n1g+jpnrykuaeip6t5ephq72ctfmatri1uti3xx8fcrtlncg1yb8+2vp/rc1vrjmlhgmfsltxub8jke/1b1ff9iy6+w8gqea17/wb4alxnsaedvhm07gprn+w0bz7wc77wtwu1bs03bslrpgbwjy1z5hui+a0alfprmwla5f49119dujjyohtukdzqmvjwrvkpdyzlpbobvzu7vgy5n213jl4eth4ta7kg0nya7aswixdzsvuoaoofwdus5fr8ov7p2s1fz2rbzz4xucsxzdwttybt7hbkprgmdmzg51+lrgewjkpnyw85h+gspy1wjmhbpkjbf29igz1ju0g1w1v0rp9sjeeyjjc5jzhgbi0wniayjznc1j63iwsugzurcxjym+4db3gryutg3q79ofutae6axuom1szus07so7sxzns6222q+d8cwwu9xusgg7w4hgt+1ft2imaavnx0jx5a0nk+mh3hf4p1d1kukin60mkqjqezmjb53+kn9mqw3ezoya3t4bbczqd3iv0lhsu7sdkdtgbhysuk6rpfrxfdfq5rrkx4otdn+dm7sng1maedvqvtas/rp8ay3t4rlpuvnvfdicl4jlhydg+b+pnxo4xyt5lw25letmalebkz2d4al6dfkdtmtufaa3uzjwj5duxqmklwojkqkg/qg7reowvgn1bnfzrulq8rsibe7tbbo8yugupo5e2jimzo6icnfnjh83tsfvgl6riop3uqtzvoy2x6no3sbofvbqhdrl/aenzs4xprta6lqmvulb36szrq/kb8xwuuw2pjqgcsm6hdvnrvoklkp7l11jmhrx5y+6mjjjjizzupc094e2j3xvegigxfxagok7zm6b25rnlfjpp5mg09oov1uhb4illj8cly7iphewycaewanzh83fay6buplnv/wbpfgho7pblbhgclzh1rkj7rluy2rhanlt1a7yqnxt3g/gs06rg8s4ohy1qscx0jwga+s36jvychu8njvckd8servmyd3houaewvmcldpy75reyvy2bccsgvskexxhlqgva1+rjo4/yogpsvf2lphoypcsltdtwird7vufp3srz5rlm5ylumgb+cuxejae9ni9zropclde7mafsntmqlrtlrxiq5rvuy1ounnzt2n/bwxaj/lls8kzu85zirh2n02x7dyfgldiiw69xurs1vhll2lrhsiowwx611vtvyoolheejj1hvwkibfj7+y8qlo1nlw+crov7a4w2g4cfl4bpjg2xmdgnts0+0laehychdm35ruxkehwrrnl/afjmtgm2nlapzjg2bqs9w91wryga39h5lfdpoo636p3rk7bvii/itpieinia8ue24ggft+g6p05njezv45iyahm+3dh3kiusxc4u66+y6sylwumcgja+3u32k2lapsonx9bks4+zzrs2xtzptwp57irpji4f30nh61nx1dhs4/fa+gjthf+jm95/aspy7kjhfokfkjyc9nqujyxet+plyfwxx1tjz6grr9m9he47v0ynb9hv/hqszx4hiwxvni8a3vly6edlzwjxck8b9l27wb8ctnwbi0maqdknjmaggzhe3q25xwff2fipxhk6b0f6sqmfqnjtl7+0kewesghiy+dznbv6vradimm9uxj9exzcmntjcd/hqlax8uxrusxynaajn/asb1mds86adlfrqqqxspc97sznhm48vidkqvt7fxqejpsahxur03qdgi8uxl5fawjirpzpt5ffzrkx5u9mb1c3xwcrt2kmeqhqfoj6ldzlhjnj/afqvxpsifkowxs+/h926jgn1l55iasefz5xhlm9sdgtjigidmx5v3ndxg/ok2paktaunejqkayp7kns0bzio/nslu5j+pul6vohjju9esxor4jxhb0phrh1lfayfgu4c8snnz7am6ksmks4dnfmxskugky7uob9rhjbnrllnmnvc7bks2lqiwlw4s2qwiwyavyapncfiim08oisndo2yti5tih1rnfe3aizpe2plfvbjefl0xb+zutditchxubf7/jreyug6fdtxti+zpsbfgbusbvkzau/srtv0vjq0w5hx4ht7icmytsqzeao1p6mw6+o881ea6kydvudgdnnotlchpjuq09li443jtsvoif8a1lgp/dj9qlgerg7tbsdr/wvocph/angwl+gh6gv6y/nxmfq/9jp4fvgiglyuborbjm36tb6j615mwlzi1pa0nutjuqohpnuiui075og1pgaiilghabhgkmozxhq7ann4lcoq91bxuktpsee/i0ek9sqdou4xdjjyjncfg6a7nefmq/if5n/9h/3kuudlrsfraag/cshfusel07stlbt523njr3pzddzpqpv4riovpq593dsxq+nzxua1ohhnfzr75dl/add//b96lsj930yjdsuqmcrbyh6n6ux3sauqvtjs3ndz34n76mszioxm2ojmrmccjtwabo1wg3p3rrjxhurogzskcrs0keeeelgyzcpxaann4z3r9wg3afnuyhl0umypunjbjl0lrxfwvs7wrvzjb4y8jax7gwsjqzmspxyszxzky1nnt57rqyhglrbl7amkjzmzbi9z7nl0vb+oj4ps6ar08b/xzpdviwcvjtbtvh+jozd3apycwwvlmohxrzffptvv1kucpdthzwhprjwkbe2jbokuupz4w3z+xkcpxdzskydxg+pscew1h5rtif1icjtpztf2n3k6xxzhmfpleiwzm7mzmxjanbxhtzrvanbplk9fjyljz93y5/p3pdedepfyqdom0m3l5y2/pdexcdi5wdh9ey5pkqesks9omsguw29uepv2snb3y2drmtdzua7xvhunwpb4bnxtzpjewwha2qt4knfvc8zm+rdvn1g4lcvojsl5z9y7vgqwoxymjlhtatczxzqtz0+srch2hhjcf+0jcluranxsdoxdg9i6nv6zdwuqog1nz8pkw0+ch/j3/wak/wdsoup4ylgx7xmc0b2zuyebjuaez4ryskvtkzbbpno2qejctoq6p6y3pvlz29anblkevnka8st+74kiraottzcinm73eenj58ivakhl7si9i/r7tctp0v2kdtkuaqb9gpa9ep857foamftq8vdwpdhjtp75xjh+iyqvw4aggi4o4ksaq6hafj3wwnjhhxkrveeds7gydll3w7m7xptotbihatdctmphoa+dh3h7l0bblgogdgsm+lrb23k6aqsk+satnmkw/yd50l0mvknlrn64rzz5xx/u+vn4rudelmh/ac3/ahk7dgfu/wbwjmn/zhbfubgb9bvucqeygzqpibupsc/xhrp0unjakvn/ajhh/rxwhw09wyoki7kmmex4ce8qrsb5ge5sn0pyznuukbiynsubo15a218urwv8qp0isrt4xpumu5iver1at3g7klmpc7bf9t5l/ebx/wawl/7fvxxprthc1psztmhde51qxta61y3s2c/wknyjtk0jtlqtlpuov1byi6mojlbjpygppwwuaopygwwulc2od3nba4b2bxf4hcj/ahm1/wdmjf8at+9ftsiq2kakttydp6/vs6koxgmt+c9znno8woapd6igwixpllewtfbysaafgvsegmsfhi6kmdblphfk76n+y6kzkk49gz7rltfcua9rpi+rr84ekvwyjghhpj8znep1qle4d0lu3ul5ew9kvc0tq+nnghmrgdfi1tr2vdp+v3rm/wc86u/mev8a2/evogu4mpor3pg51rhjo8t4echwm8vy1i7nreyytoge53ebpjv/7ldeerdgxr9mzwfbuullhhotwylj00ohijc10c0cj2zu6bqk3te+nreexaiejrgwuacdoqveed/tv8vyev0nrbro01bb/mee9v6lo8uzxdwlt5wu375izxyg5pjjoyfqdv7+axkfc55mwztsolnxanvbxuoe5b/greoyq4wbzzvybr/aqje9goti5wwh7opkdb0t076hqqro1mpw49blfh9cnohyvondszd/ajb/allympnsov0b2u+gwuzezhjftuodynqhsa1r2ruc15a3q23xejzs9xe45no1c87k+kzbposa2xkwyon6r/paq2quadfan5vb8jr4pa8ojmza0tt3tde+4ck2poqa+cly2f8z6to17229qhuw5/qlyazia+afkkbjxrtmal2ttdw/s3c26vs6btvs8x8x+jwtt6v3eeq/2nvscsyawye2er795tf/adcx/t+9w6rhesiy576kvrw6udbnydbbd/whg43u9hnlyulzkbm5vasrf2lepaccclg6ehyjxxny6dgmsns9hh6y16knuirzj2vnz3pk3kfop/sp+5mh/k3/anh/3lo3e9a2crnjylmbdmt6ai9lqvrq6bbyipkut/d+hy9x/sr1knnwdknlbcs/5ijbsglfg6qlbrgbs9bh17dw3ikmvmbg9/cf6x2a4jfkblqil7ahp4bi2etlf3tflkbxgbovgnslsqryjrce1wzdohxoqhntaxt54+rkupsi4sl2pf0yrbqrms5wm93jfk+libkp8m/+w/7kyh+tf/yf9ymckh/v2h/il+h6gp/2mdr/2vp5s/5ih5d/acb/aow/7l7kp8m/+w/7llwip9xah+kx4foh/az1h/zu/ll/aji1tczga6enf/oyuoi30slb51kwqtl5herknciiaciiajwiivjz2uiiial0c+nvafeppgdmjwvdw5zmtcpv0niqeeuitwtpo4qkepn5fa6uow9n1j9jihpgx6soqtstfagj+tknnp5vd11jt5kwcpsbgyfjdgtaapvkgnfefup6utn3g97pi5ndwl21+oupvwzxh7gi/ebb3dvq9rt3bpu0tko6tuhxi55y2idvqhrudxq0+sptw4hqbiatsvrgx3zr0wsdo+a3groiyvlpjeltzwsv1rbluefh0tgxhrbkag+qfuwvw3gi5aglwb5x+5burka2ic0+wisqynqrcpol5wzdbizjbac9gglm2i25ln2nu5knzm9s2hcsxhxkosnfvtju81fq4gojcnw7dqfajalet2lvhssywsmzjuvei4gc5ere3lzk3tntinoynm8+p5kql4txdtrtgf7/amtib+v0ymvvgdyo11lvbcwldca5kjqqbeowrevqaiigdm/pobmmiozw3pvxmip7yn6e6d2rp3pntdo5lov4llvrdjmuhkxc37nfwuukrxuys2ijbqgoomv4yt8oq65huie0x2k5pgjzjc192xmottnaebaun4zjldas+4l6yz2nymlozhuz02bnip5coqhdrmgrbi4ajacpkrwt37mehl77hvlztgmq25dqpela+oxevvkjbkvbtxc/ijxpc9wrv3k94mdh0rgydugqjtuqnri5zc+vxougoadlxc3mpzh8tnzjyea2nrklsvghqys27s/i/wacezhtvqqco4l7swkpuufyq6fgsazobi2xtwoa1r4ydhc7shxtrqbg6esfzy5hfxy2wjv6vmvpaopoyy4al2ununnci9i8izsenchzt5xv+lcsluuzfopqh4uprwmeqzdk09dsqhetdw5dzxhl9i9k0jkkzdzqronmr7ysxiug+jv0utf5s/6ijt48efsuu9zl4zx19huxtmjbzwbjb6boq+oh4c2eoovrg7tgbzzrazwrs4ddv8tfjww/g3/pehvuc+gpq3xm2anne935wmhczexfdfqjra9j7elscksmslww/vmv5n2bzypp7lz/anihfhihzru7z9apd6r+xdu48j7cb9sbynfpt0h018vynxonlfi43lzoojeqavsla+vvwau7r+hlcmf2jsxoa7nh1j16q/lruuluasds649y2fdqejndrbbxadfxiwrhhrneawc9xs2ongliejqrxizuy6tnuaqoggukl1ybbwblfkyyqgmlcxahnkxzqfyqpt+8+pagt/c2pznqamecsffdewb0kscfnbvzynvs58lgz8v5ua+psziveqve1fp47hiqagcqtkyl7f4jpshjblc+hpp3bsuels4fnyw5r5jl7v3ndfrtqrwziwoi/lhknpm0akyuddhcwmhhzewbmjagj3jmhg2qs++8e44lh3oiq5mpqjy6vh9zjt2ktuga0hvxlqvdzfvvmbr/ajcv8yj3shag3ilh2r6ox3h6amf56ukedk9wzeqanvwbiqjlzuvfxrulq6lsu0qah8zzhmbsxtj5wyofquo04tq5idh3nnw0vqpk1t4k9tcwvvfw/wbqwal2t1dj5zbs4ywtelpef+r/ax0d6k8ze9mxrjd0r7j3s2pusvnqfdt30ty72vs+aut2wzmvzeoxmobioyz8jropespufsuzgbpomgwqp5ezd32kl3jouafwyyynhlmo5r4jus1b4jxckbljiflzb9jqc7kqerxjas3tp7pji55c9xajs21i86aeavv90omembowo27muhe8afnfiobxknfnp6o0b8pfab5gyazjvkzyoqcl0bqac59rzyee6llsawc7hhtjd8l99zzvmxe3zxb/sxyvmhxs3x/tbd2q5axpubadt3blfnng+k/kqyzzddkx5jrutjqqo7zn1fcrzavnkydmx8t1u+fq0xylt9hi1vefgrwqbhqvdw8zjwnaxfz5hbntu0vyy9pl3vjvkmoeaz0owpiwljwlhzjf5348fu2g67klyso4nwow2kwpq5x2vqkv7nw2hx7vmgelb+uaolru3vx3t4lvrqoqcmyzfs6fit0wjk3/aavhbja2la/vkadvpafnpbswhylgfyu4h7clyqpfca9hx5satkjuwwsa2/i83/vcn1xiccb2xytnasawscdbw3axayqtsz38aepji28vk2v52ibryefny9fypdbotolfumgmsxvzibn0lhy+3w3vxyn5c0oeh5xzu0sgu8ibuozntboclpluyly1wrm4zpa1sxkilimypczsnftzbf2rsco1wluujy5ojzqdxstcpmyt64dz5rsetgvfjufaq4q0bbwmvuwilwnlc4h6ucogu1dw5c1i/wb+65nebgltvpbia6mqgn6onvxd4dorz5jlj+q0/mbexy0/yzm9ohwntxb4fsxs/rrvxy+mm5y0e4wflzkygmaebd/epf6ppf8asdd6zcljbtaqbiqk0thvurfgl0iiiax66dri3l+xgx2kbjy39ijqxadn8hjcdr9fis3iee4zgd6vecpejqe4ffregqcshidod2e7fvqlcjasp2sai5e79xkw/uy1b6ds+o3vxjip3srxjsrgunwfgpwwv5vjmxhe2vwc3ni4gi8dxyi19y2jfx3w28toqxis3pdir+kwzszb9z/ib28ffmejyxzfnpib8vvqxrluvcn8wcj+mpus9ztggn4cllbwdargpt/6kv5xvvbzqes/hsembbk36lqpgqzyakgdqbd4qcr1tw54dap4zo8dyxugmw0pizve+30ispoy7sm8rzhk1a00noclv5f+qxelvrsjmebtszuc43ltuau8ovrw9bqlnrnz6rqfkugqcs8sjlkkwmhht7lsdvuztsrjzyfwi0cljjewihd4n3ljkdylduhj6aphu7xpj233k1jjylyr3l2j7lajazhmyzv0jgxo8svhkwfllqntcmki3scoy184ylthibmmmgwb+a083g1h+xssct1vmyytw5jaojlidg54emuizcrfnxxq8iwoongbe1uwu93n7+biea1mmcpxva9r4ri1wsr6vvpnc1cv1uq5a2pqlc08giozxi0vcwnwve59n+ta91p6r2mr/un5c10qi3ak4/w3wg+ktyymzybu7tuk73aj58116aqrgdoq7wm2uc3npzpn2f8bvakpvpezyco1id2bjbt4wxnb4v6lfulthk0pilbi07oaqqnx3wurstxjddlaqrckpwvieswkhlc3blc4n6six2jtl2nwuy1a00oyddvrt70n1zfuoqcm3txp3p1pj9ynt/ucxt9bhskyas4bsrfkfsxfk8wwfax0hh6gxfidwt/hnduxqf8a0nbf6h/afp2x86p77gd1f+kn8pqilovf6uioeciiaciiaciiaciiaciiacu087o3ska4tcxwchn0o6tikaysmvnp5rmswy4p2csdg2do7osjke1ri0a9ozqnvg4bwljnjhkkzlcx5zpoyqgw9zpvz6komcqqqscnnc4psknnozmdnqm5irla4jw2a+58dvrrrnqptwey4/f0na2ltu7ikqx9z8tpnhs9vck3714gdixlkzsg4vljccxihdlvplarvr5tyoc9j3xfxbynswgcwbyuyry8bipf5umdtoxotwjrwdl/enbhymz07xyi/ezq5zrbv3iowvomhrou9h9li97w6smvn8rcmod1akvw1/pwkvzme/6jrlqt8lzx6hl2ov9jlk49gj6oxi5we1wvhipnnvzhirba5asamtuedbxknnwmsngw1yugrga5xwlmalmzgqcrjsscfvgpjrmmzlxkwininq4cj1bxqogcym7c1/rxwbp0hb1vgucgripax8tg+n5y4cxz8coar16kqrx3llrcujppbujri9uth41j7mf0tu0ghy31t4hyodxu3kbuzs3ifwy+zkzfs9tynz7bq/xevui583i6oztcszjm70yapvvsdupvq8rwtpymc652zcwj6dxrohohiuryluee/mbderqloiiiakhzlgg7hqqtearqhgqlaxetc+5jdxo0guyiff5izkyggnrbczvzno8tsfcuhyritkej8jzbko6obncgauovnqxve9x70ji4+07lssloctcnsjb6o6vgcpwstf0lb3lgkcq3uwo4rxijmks+x4jxkeegxbza+n914ifjjattzpeiy42rpqemiehz1ja1wvoyw7xd0oi5vlewuc1wswolxdxb/yr2h1zojwsstmybi+22xvfxuule+r5u6rxc4jqxv0vahq8jtlj8y/d3f2mkll7y29mp+uswqng+pxizclp45zbhloywu0blyoahdhecsteflloexn6v3nhikl/kda/mdgmwgu6tlvfxot7q+kb7kute1r522zfvytt671tged9lutunu0ojnzngefve4f7sm8nkjynr9jnledmetywopmepvvgmadv6jb43t80/3ua86le2xjq2z6rxk0v20w62sfni+wr2z7zdx29ghik3ewoibcgjdzjyhh1xgjn7azjsa25ueg6qeuhb0cnlpnwmxdhcbl80q8ortlyq1ouopfbjfk3tqtzjtdt23wrvbntfm9op3smfgwtjbdzm2gjm9d4r3isily+j8rchligvhtdrroa7x0wpexbfi5wbo/ziadavmyvjmls5r5hazwhjwnvlgm4hk6tw5eiplj8rffg6dhloro3l+/1nciirjsciiaciiac8uvuqareqareqboerf5oeyhwausjhyzjzwxmbu958ngoz02c0xengenic0eszed2ebdxees5hjgptvty+wun6lpmnhrres0rtp863rs2j9srwuvdao7jxxn6qntzoazpiiojpdpjiph6i8pep3wxp22dwoa7mawaakfwu+4nvjwxby+wklpo745dhs7g8dpsvadaqdft+vaoo+ryxs0yxoy0lgylmm7ieosfpcnvewdsqoix2hgscnnjrb+xvcopaqwhqchagxvs9nh1hvd3xsga0rzwscalngegzuosfmukhve/c7ktmzpdj2dup5oh0hfal1b07ulqjv++peynt72pyvvdqbfl/ks7bayoefkjhbzxabcva9fxuwxbc4ngfenthsxaq7khwlpnxsfedd4rreg8sqvba+otx50z0e09cfwl5zzt5b8hf29xgssxmopog3uo7byi4ktnxweluitmohud7sr+k1fmkh2341wggj38wqsjs7f101jbm5/fhondche6c258fd+mmveywezq+qkdjrlfte9znzb3ryx9s8uccwtgmbw/9vr/g8jknhfsygqmjf8ndcq7o22rz2j6jubrusqanll7gbet04er3int1dgs0m5vmat9lmpg66hwjxq05aaokscp9glf8yxu8oxuxk5izqdnm33672xrzli456j9lmfpv6easnevh7dkpzchlh02ihfo94nnveyph5pywizj6zo9tettbfyu1axmvqtptcgakjqudspexhcbu9rexecb7fjvgjqxsmklrgxg+c5w67ac01u5pslqry/0izhtnbx1ftpcy59w6hvkpjxpi4nqphtbyoay3tci25hjrass9vbddbxcyjmz6ryzmwooypasp9ozkb6a8zbmdqu8ucmek4oobcl59qgwdm3ytgc+z1+0lqnbupcsmnltctipg37ft6jtbsmjq6bpmdjvv13zsb2kmvlszytbqcrq7r4yzgtttz9k4djkizozlerxwsqsgvpg1utmu9tsyhebjxc1vb9rv0ehibvl9k43p4zdni37zapm73vw2oxksyls9t2ikzey4w6mudjghv5wcpbbmo8mtjzuztnkfjvft3bdan4qkyojw+b1m2o9repgorv1e2izbptxubwzzmqqxhr3tgzno35qepbqxyjtnnp1oy9utefuoexanyblxipsfp6gjuxouun4xwmjaylambr7lwzibevle7rhut7rfpqorom5vc9krxlvqpnllmtz63vt3abwpwvvfrbrigxr6ncc3m2+pb2nwt8hsxs0x+jg1zvcafqug6psdtc57q5gea8oaiyk7kc19h4m5hhilgmacxpgvrqnt7puvq9jzw08hzbr+j+vl1zhm58zr2fweqprwvwvi1dvq1dmmtkdlkb2kheijs5vre32luc1zgwevmywdcve1qj1f6qsoi0+wid/kgma6z58aanepgxju5p5kw9owpgggjp26orx5xds4iau4fcy5f6oedp3uqnxummucexbsytaho9azwax0vz2vky6rxbh8+lpjmfhsvhde0shfifqizxgn1hhfqakrg+hqcl7y02gudx25b2j4k0pfla0guntcp2cik8socmntp6nslaxrp3oy7kac9zpmztn3g+q2mgcluvm4ogoiyndarolndyj2uzfxvxw72dr0o5zvvszi3xlr3nexameqqz3z/wb28sudo8nox/jx4nj1d5lmg6olhfhg6q99gstyddzjye9agv41w+d+exkahbkx4kdfoq29laanazjruuukv1tn19zhrshjkvclezv0lonjmfoxf/hjdifynfphuokbjvx7v3++5mzx/wbvduh4zu1zv5zztt04/slcovimnvkzjhpjsubnx+5udrurkn9b7h6vvc0wk8bupuhnrmu5htw8uthtt8lbofaopivpcqi0xxpioievprmbclw2l/wd70pe6yk+c+79/msiwip6d+d8ufm/f5vjmpra06bso2ege0rxyrxftoabdv4mrsj3cioh0davmpgmxk5q/egssczyds5xn/mlumq3upty+tluojco3ssikezn1exywsa+pk7tpc3k0enrjg8gq+noghyfjfdji10romyybt7mutzl+drkweimukvs6pq6qglsy7xczwblr7jr1wj9kgpq1da+sgqpy1uqsnv3jfu/frodxjoqsjsibkx0vqod8t2vy4tfg4oa4cjfdvtksqqjhcnmj3j/ahhe+cpsvfunyyqiocaobsgunt2ldbmzhmaba8x1b8dyxyjfdpbbt0oo1810/gviyo7szmjlfvza+/qs+tq8p1o8ereotc3jhneokiwghigwj/f1xv2y0upddrcns2y0lbxhiwgohf+zb+xyheftjkw5nbky1lgk3dps4qkvzdttypvkblirzr0iekmujpaz2rhlkm+i3o3xxnixobbbftjtfzl1fq/88ho9qtcphzlqvukahdyqvptyx2knvahmtyb3vo62vc4oe02vm3hsufdlvuhy82d3jvnxbaoqrfe0p3u1glj+wkucrg2gvzmdruvhu03whje4m1ua69eqtjketb9zlfvib2fx1d4dqfjrvaylrfnbnxmdezve4dxefrietwgn4qro8ans+zg13et7aso71scm5z9modetfccikse3pjmvrhvzzqpp3exhap0xn/mfojoi3e4agu0vr/o5hmcrgwbpprnjbf1x3hpe+wryxk2a6qqv8naa+0nx0kcldw0ncaten9lzh3amxwdvsnhgjd1gzpaslf/woyba+owupr3qnfkvj1fpo2zmzaqpk+ijtaottj714awyaioqnhjm99lry+hvyhkkqhucw5t2bnmaw39u9d1nu0ndywa5mn79/wb/m2vhilza2sn2zrhq4xvddvetv4jbe1odggna3klwt0c0ve2omhjdzwfh9mypsm0uryxzlzej4jp5asmcm6vpedsa3qtyxia2n7ov8bxb/zvlri3ugx5hmuicp8e0wqals7uzawwin1i7s+zugutqozmqhujdcl7jia1u+4cmoaozyh1ftu4fgxpjie8pl/0pr6pzaoi16ge6yivtzrnx1utbyb3uh4iqmipyc6xojb/szbkeus02vi4ujtkl1ygj4o2anjazcdmrs3t9i8liuafstlrtwws17inqhrqpcm5wqmrzegmr1s3qt1u7wc0lpxw0ulziczm0tid7ddr/fsbdusezmjwkbrdulcyvrwvr5+listl5dzevou0lszbvmvb2xmzfdwantjjgtznas55af8vxmtaaikqlihjli7nzlq3u2d015lx8q4djnjgqtzgfhy0hl3lzuvc0godcpfswghb6hdk05zhjy5wmoukq+p6udtsg/pkyejeykxuua2bud1bcs30vloqceah9wdrrceykgjihe3ly42y3es64+ivskdfh04sglzrvd08wfcso86vjevt+k/q6jpnpfccvbrvhll9f1jvngpcolxru3ci2+bvhwutjxwn8t5wu0dbkhcg2xchsejkc6r3m3cd0i2ep1h7v1f9jb1qhgiu+7/l9fgu4zraeoi1auvtq3uptxwhmrh0c6rlbwfwo5yywq3vhk7lsrbylgj7mjuhkvy22cftyvxgyatdsfqdyw3uv6vywpxprlnojbmetpwsa6viv8xr32/ota/xkj9rnyelbd0e1ober/qvspafqvqmmllhkbvs6dlxj5jnevlqdbk203wa5zpnczfyfm8z5br/eat0jxehzwdwq3sxfmbsfbalnzgoibbpyxmrm5ywzuzw0r1dzppkmmggak0nfbm7gqxfoeni+5ckva39wxh0tfh00zz2pbaovzo3dyksnloev4yedtotvumiukhy410m0ikbfjrpa5jisdj9hbcqycl18fvh29bi2gqfw1ibzm3i3ltuftqzh2osn8msfarsczm6gkx2pw1tfgoubfkdrfuujety2lr6cajtat888/wd0nptjk2yry5c7e7o8r7vpu3jiw5zijud18vjyk+0ch6nj+c8hgcixkwuiyub96pxt+ccppakvowvuei4kkfoxhujdpoz8371gqqqxfug/vwx46afbm0g4b5futa25pkfpuv6iktz/adgsoih5nnujtzuu34v/akqwb+i/whcsifheomuwxbcxp/0rbv6i/qhafl/oiyvv/wckn8pqiliilojhaiigaiigaiigaiigaiigcpjbkc4fzbmdhruue2xiudb5w281siqcukiuc1rrcvcggejk7zw/grkwfsbrqe9i82uxw1xg8kid54gl5jdpgjtg7t13b5lvebbac97admdzpuvk9tm/vidl6p0o+vua34k0rfkntberaep40ws1la2njc8pe7r5tcfybtzk5xv4bntkcaf8v9i71t5o2xdhmbtca21vitoipmhsstzgg3yufxdxbe9djawsr8thvukxujoonix4hd2uv4oxsmt4epnsciwdhju2qxtfo4cwue4lhctm8mmaa5wznltdpf97rspxekv3efiw7ixrw28+pncflxk4hlfa5xq5steuzgqhl0fwq5vapmcrmvhy9zkxmvwznwoui7mw+4rhz1ipknhd7ftuczk/r174xtkye83lyi5tkzui5qarnrqqfsmpcjnyrospda0trryt0d2g26hosxyjwhhnwrkplkciiquldxlegqrvlebnanuzpjowyuw8b4q6somvygq6zerfzcvpb0ffnp7fo+uvs9lx34xvnxjgny1l80ju6d+tihqshlzk1tnlxz1yc666ceffyrxveu5tyk8thzrqheuqru5ciiuuiiial0h9vl0xiia6rwnvsq4htzb3aq/lkeunvtzylh9rsonxzdi2pkzi7hygxllzjk93k+nwwbhwkpppwss3adwnyt5tprtxipgo6umy6njekrnn7whlnkawxuhdpdzrhkjw1jeq/wadcvwf1a6jpe4//wblt7zzcdyztggkdjazcpzi4m/ev05lb8u1ziawdz2tchnyinxy5yeqxlmj4kqktoii0nc4udg5ugd4dkr2o8uyvccuckbqyzml2377rfr5brss6kq2pvkywafvkmlv04resy42b4yemwycnrn00+rrj2wfg1mu7nad6xwhtojbqhgihoitex18wn9he212w+xbgy54oye9rsygosbzpvbibz0ajunu0wzqtlcd6zyscleqw81bpa5juxjl1/chjkdwmc+0yyeh53wumzghxsbd7g4bw01u3da98zg400ob5vtk3oey2ypjclix7z25hu1zl8s3pospxwpinflgaaodiqcxqtaoltdtm+cm1lipsy5ryvy9pjb2dg4xgm8p2937nl9tlawxvsx4appqxra07+wt1cehauenbkksgmxwey9mvibdt9xfcj9k8p1ftt7yk66bwt2ljzt4anwizqujaewruermszszlzb8wzrzyksxkmsoozg4pdciicnciiaciiajwoxxpxy6egcndauj8pmn49pvb+d48vm6bnibhrsxg2ssmktdnpzyogxijpc9xjcxfxjljutfe64lpdgp/wawotuy8z1a6umeph4mpqjhekujjjuxg5jn9yeasf6zz3clhsuh0fat1rbrrs6rws1id1xhf+a8cdezi5i6dwb6qxubme7tpqth8rt7min/agsy5eixt8tw9rwmqkeut0kwdoqhmoh5r183rykakx8f8ez4a5wa35rsy/xjd5pucobmfrcp7e5lrlqxxxmu7yzhcrw9n2f6k14g4djrgg3djwjutdfb3vc2khno5sdmieoeuv46g813wmp6eth+vydijyt5aq/w8dubc38e1alemliqgfkseycjs9p6g8lpvkng8hqjz++tjt7uvyt0vft2/vebh4mfi3i46ntx7dzw04dgmkjwwu57rbvtwoxrgyac7ogzohrdvrs/sap76kef5mofxos1uuicbw7+v+0coqstzcpfdn8d2j/vy7ww6rgvhk3/ah3jy3hsrsblaja1vbe3loraglbovplvcpdv7v42ic+io+f5evjn/eoky96prnnlozxc+tv0tgdjfncxxm8e4flo5mkgfnjpfi3vrhfkewy+ocsw4pcc3syhvfnbcdu1glzgx5ix7daxi3i57kzsuprau+ccpqjnzhyrf0u8psaw1bwtjkcihc5wsvygjnf7f0ss4bpahxbooxtmozwptup4vkzngmg/e2uy+h+kymyrdhlsuz9x7zfiowo0uqdwbnnsv06kssrdsvcboguu0eknefe7g+1rhicua7qbpp9a6zxrhrnrpd2y7lntppq/sxoomgaohc31zwb1uxkpld+shlmkdnksdib+stvpup4ssipjsqov41vmaej27/etjmx5rjhjnczo4aijuydm1jwlf2g3y8gnlawqesjfh2jhmd3eqbg2629owrwrgjqz2aktlqcwnvp8coa8xpfjah5llfmeefk3qdkllfswgnhocj6kd74yrmymdz17i1tf5lg7qxcrjywnng5hs5huuv8icwmnkyxxlnnjw6glu2h10fqwoa9rg7uwi6bljlb0zhqurnprx+jftthjspllq8cotnfanmr9dnb2trmte2vgcb28l81j6mkhycrlb6usuvcfcbtb/o9o4oldhsd1qfdqhudv6esvrtamvg1vewngwssfr9mpkkcl7hvdjhnylng11pmstxw1i4gqwyyguy45zdnoy3vce5df/ctbho+ub7a3uyphmglrf83n4havkmqa0o524rupluzmvftfohlmfjpig8ggi4uqha872wuadspbxljudtk3swbkultgwi9nc+7rybolkkwx3j5kquyi5tmxk7bwxvtvvm2m12jvejmqo6fjghrlxgackabnmuprxkx9y3mgyrjfg+mvmkbhozojy8tata1yoaer1tom6/lgdozwwjp2kh+exbextsdxmtfquqdxlsqxdcuji5glcajktvitpv71ycxfgdxppu3pxwo7fejpf9ykszqxipij0yo4zpa68eenqxneqxkwspkp9x1r7fy/ftg4/lmdw9x5oiy+ajychlmjsskpzrestoqxnd7inawkqnv8vb0x3g0ztegkmpcnpi2b8tunapji9llravjerfftmwqdfccvzfdbzqivj5k+9enicdmk+wpnafzn/emb6sxrobvmkl/tc+q+8ly4xkdrsf1d3razh8h+zbxngq/kqhrtnb4fss6uhg0e7ye1gkyo5ho8pqusqmc87e+9xnmadp3vznad2bzab6ui/ngvvv5pe+espxgvurajodu4geczqalvtobz5pffcho06/8atshd6lut0guuv2rspulsxrck0iylyzvfigfm7a5jy8qtrvra6dqbftuyqygaqow/qejkj9bhzujd9vvt6sluwlkjhpi/k21je4p4skbtqr8sxdbwfqfiyg0sjmwcadvx4ly4rxzjasdyb5dx4haydll1fr9h9qzcpp7ybpflzdr2mvgvduxqvjyon600d34bxytxs0jiagyjftdbnf2gqsh80/uopwjpfy6lr8ubql7qu8roipztv3bdzi/asbxskzvqffr8z1ts0rz+e53x2wo/s6z8tozfm+n2hblt53we6ztb2pmfb8mauzfvnses00qbckmd45grsl5bqwt1o+9lr+b+g2v1uypzcxjw5y5vm39uhkuwyfw5t0mjhdhyscxcss4hh237npulljxy/aaemtwn8yendpgadpe5hp0h49ueantdv1evgjorpf87mtgbxo496i/ehb7mhfeezens0eqtbotw39iov+dhhtxbkxho5poamsrye34kbqlxve3uafutvvzjw2p+alm3mvfr45gzg4gefn1bpgfq7kkmt3nau8g9pbov7+nuhik+estp/t6lkeay44koyjabbizi7ne9xb3lvvo345zwu4bkmk0nopl+q6w0c08tlw+f4dnn3y2c7b1r6j2cwu29hlpyvoh07jyixovpavldjoyq17hbpa+iakyt94wgrmeyl5tcdfta5raw+gawi4vp4rndgjxbc3iqcq85cikjtpxe7njw8spswxsjj5rmxg2istati7vo7rwch4+k7d+48ubsq25+kvwn0osazboog1p3j1cldvjkk6kfck4oglgx8vv8idye9b29g2+jwhjoptyh2la0fryc27exs5ba1rzrl0xhlqofd2v41vdoxryncnhnchbw89cergws7kdj9hvemmmuvq9pjjnkhs5o70nestqaoz8ra5znwxgbooo5knttkudr3a7fzvufy51c8ab2h6lo+bo7sbho9la6xbrpyk13oc9i6rciz4rdroraog41uvbejajg77pb9qzowzgwnvyrimtrjy7twy13ovjpbsus+2mluouwfqrxswuhzdjufmwpa6xgh6kt8nr21b3hrkkqurh4yzccaqfytvgebsq5dg+bsq1pdmfsxn9hfpfvaimfu2ov5xudbn5+66jxbjhbmbsqkfrsksrynbpq9m+pa2to3oyrtvkfz3r/aawbfbzghgrmll26b/2loprjtpqc2h3vzko9+3hsxzfo6aki3nxcq8kkkyzzksvcvuctpqpizgksyov2qrelcm5lufkssvwbnisiv61ttiopm0kmdbrpr6chv9yzvrvpbfibn1o5g/alsvbtd4rp9hjb4ps/8y/llwtevmgvydr0ygnd9p1ixa3vlxg0plazpict7lobspmklcu1e+g8cztlgrzhfbo5wmrobutmjc69p6sbtbn3torzgq3gh+koimdo6tho5w5u0zk05ljo7x5arlpuyucydvwq1idsxaxvrskoiy4zmov+ispefrgzypnzyd72+1ylzw0ra2smxsnicwh4jfia1zsnbblsspb8uzzvjdqxndnbjg9v6qi5jlsphtnecxolw/h3jw0aqh4hrwi6gwvm1tunymsfvqesiswkh3hxetaaf2ozfpyjxtv8vvk7ecrxoogal/bcj49rzj3l75cn8keu3iosrranphytwg4ruqheasysveds43jvvm3bxtb3rjpclz3c46bpdb2bxxkmd3c3ir+pytelxcmypcs9axc28orh4am/sxa8sp8a9jwx+h/wbctins3g3t8e1dsxmf8a0jbp6h//abhxbp8anxmjq/8arz+h1rgerf0rwgreqareqareqareqareqareqa/h7qv17gfgduuwdnxkhpzuppl81x/hjchug4nxf5putzpyxy/k5l7eb8nbkne0fepvhk3nppn14fdz4ezoziqwubainwdifuueo4ciiaciiapcuuceysywoyym5ha0tc8wsxe7dyu44wxj9psspjtmjdlnkduquna/e3j+1antqgx4j9xznxrztfui992zdzfddlh3vbzfqujzckuotnd1uhlea9xm6y4linqyc69zlhdl7mtcemsymyzlyzrzojaus6rwduxgkznuwsgzpogjkpcovwrhojpxir35+84n6pikulbugnvlg7cxulqjq8giios0fybjyncyrc4t7srawoho24k6yuc+kwd6ln9bpfufnzxlcwkyxmzpwoztw/ldietdulbhb8lfvtmja06kdpiabnbfulxej8obt1uktb3agubz5bfbbnir16o/jyh2efhen/dzg1ciiliqiigaiigaiigasqgxgwb+ekuxu2jftr0i5rfrjkkksmdgti8xegsoljkazxjt082fcujdt53g61z6qne5znuz2x17on+l/m7lwoolqhh7u3uj5xvwaxn596ybf0ep5mnjex6l2ybjddncxzuv7yg2zes8tpempqu8gde3msfschgyqfajmxg5rzyfnlp+d4jstnpdlidtjosngndpu7i0bnnu2gw2zhchxx57lnwbghurzkyjj32ytc+/d6kdmuqydwra2jjzihk7sw17n638lclztiqonls9kchysj7ozyi/56gpxmk7dpbculcrzxjw1b/rkgxt0hvffh2ebozcbve4bzntwt6rx4turvzi5xunhqmnytqpjdxgd14ystnd5nwub0tazi3ysg9gs25ul89lckuknj58pzpsw7ua8cen60zjpyxw9qkmultdricoy+wrja5jyc3cnvw1jlrbdostwrxhhjkxlg9lscqrqnwvfuxpjag52xjmkegixghcdkt2niiiuqiiiaignyhjusvkebx9zw8mjywklm3y6dm47nwcu1u2y3pqd1w/s8stfuxcfqcxmkkxhhhoqy+sy94/f1b0pivcpvjcjy8tpz0vvor4cqji7pjxklksu11rrrlw6jdmhg2wph6iimbuutq6j7dy31xc/qvbs4ebxysi9iehyhlbv2w2ronylovsyu/o+jf8fcibt5kv8w/ynwnkd1regr1amksdm1lh0v8auw6nlgmhy6kr9op2odo5dbqnppzswl1uepxyvhmnsxyupnriy6ezkjixpcwm11lw3sncv9rydubzwkhrwzdyi0pxvdqtedwuhpylptlsfcnjq7vjtm7bxdsrujuarjnkjf7fxlghytrfmcnntllni0uscv1v+pnjjivswr7f8izh+vybmiynrlvsco5xjhfaur8jrpbaam/ndw3wugxzewbgo7rgucb6dqcyo7srynjdpigue0pehbyc/wa0dna6qtqru0jqoqtw79pmmxgoehjklgdjflcndhwsqr71xtgai/zsj/gs5ophfqrtwhcpcnmdsidjmt3mijtmb9mbl+phvxiencjdbv1ezn+9ma+2w46gk3rhitbiq7wjee5hilpe6+oo7eexqfzqbsjb1tsfdqrdreegxhreyevut+pyr62zlvdgmg3vy00kojivtan5icf1sdtq5sxbq2ro7k7mebgoi+c1eiyrytapvunuxwyu1vp9xunwkmsfuhn0pz7errmenlshvd3+bcvcql93encm63xkdmf21hr+l0uei1p45qo3gokl5nys8igu1v1j9vby6qonsvayuuze79apeqaw1zyvd+q9yqenkhpk2dbsiuygvybkzch73ffutt46rgmj02o+iyclhc9xdwujdb1qsbeaw54hwswlztyoia2yfpaatkcpmk+qjukrrvvqb54q+pbqk5pezzssh5nvv4yefnsmb7qqtt/kv87mcutpjyjy3xcs4+5xnrlzqy7vbbbtxd573nowfxrg3lthzeqrzauneu+iya34qttgzm0u/sjktuqsqru3+/kwu0t82fn/ahh3kl0xp+1cf0gd4fzriwjano9n2q40i1etqryncixhen5vze8j2kkh8rhjjf0rc+9bgz9gsnjc4oyojvb3fntjci56ljh3v0cyx6a2wdw9wvwv7hsqsyiwcvasoybzujeqsw86dpnso+ca3hkrjsxkbgyuj3d3qpmhioo4hqtspf3iwwtxxg/ekbuaemzrduzrkpjgvznd1farvpiyki0y5bcmulof1v0v5tvraovpunkpq7mzhjxite3fnd48mxwornaupgllzjkjmhbuof3sy9xdate5p7n7jvidplompb4fm9juzagjpstc8xk2m7nnpesmx6j61wuauottlzkchlbll3jz+gs2ky4i4yqsn9l9oaonprbp57ohq35qmf+qg9qqttlusxeln0zgdbgkamxozncwsnksqt7os2fstlcyilg419v7favr3xvnecjmd2rziyyx6zo7drh6ixxszapass9tzw9rxl7/aim1andvvq/exxp0iyi9srpmuwgyt6w9b61z+ubhr+lr6j4qpgvjdca2yb+itqfwgojakc0dqosb7dlbsqmvp8ic8hxjdzrpacliqcgurzzm5cxw1cb7kqacmvlc43u5ug168gsdako8d2ze81jmrb+jyw3qq5oha5sgerb3g9dnj02vko9tblqwlji1ph+imlztsaoowemudrfuztz05lidigqghxhfg0xcho7twtcae0kxg1qa2z4njjibnedrdw+9ufgshiviqgliexzgzalrmhrovyit1lx2xlhy07psqljlrq5hy71ibj7fbrm1ry2r9++85ghoobltinzjk4pebam4hhdwphmdbaga/tv6ndtfjlgtnsk2jiwl3x39x1vzxt/r08gsdp3cxhpuxlsonnhs9vv+gy6fwbsobuzrapyprun3jsptk9zqtfcanlnnabqqioybzm5uqvtswne7mhgqomjcsbac5o2ll8z8w4h2873/adb2b/6xz/sziwsanzwlvq6lcdnfmf1/gwvy0hmtmfewmko92ylty3hl8wwxbqqwmxpzfuv35kwdvxljtg0frhkr1nt5tfpsrsmu4qazaqjhhuke3x6lals0a+nrexz7m5nnd0nj53wlxzdtcbqau2i6owzhq3obfwuh8o1qywm6bkcpiib4d7vlskfe3ib9s0bpz5ob6yloocwqv1uoaynsdhqtva8rnjliwomchodt2lbqqtn2n2k/dukaoasgpuhycjbhkefvhoaorta/jefptsvbfbbrxwkpxg35fmjbfn4o+xxc4b158kjb3nag19f/af71uiwnhc9skek02wsxpjfccqslbmtfwjffkx5akjymlktfmvmzfa+yprl9jghm5ayrdovnvbwrnduojs1ketxvr0/huw/9fugfe4z9cgr31brqrdy9q2/aonnpk+nlkown14zx/rdtnh2glkut0zpbhzlpmfqvthrh326eboh1ec1akwwgctdpsdo4ado0jxtmoak8dmuaiicclgi1ilbjqrnyngwsvlw1rw3bu/ahjbgn8m0z25rrmalwlnazj5nnsfawpby4htziw0xsmtgplmq0b2wpdvnbnneahr1g+qjjtnizgfj1uwanstfuyubsvf8fxxzi3ob1t/co0apic1a3l4hwptlnitjcjk0nkcdjo8mi5rtj3d9ywemkogluy5gymtk0rytasw27zy4bt1flxne65z53scr2yozctnmvucrfvis8x/k1mkni5nhbotsjaxufavkl5km8r4rt31rsza3vhvz3tsgxvoafbpo7xo9ggj7fqkwkiao5zjynwgtltizo0e0/tvqefeqvajqplmiixbnt3gfsxbsv/wbu4l/rf4aul07o63xx/au0yr/qnbf6l/afcs/58tj6v/rz+h1rf0rf0rwgphoiigaiigaiigaiigaiigaiigaiigcvci8tzqyxquezizhbmrxjlctu09pbdbxdoh4s9vtnva8rdfau6lc6jcmaix3r1/qqs50zktyk9giis83aikny1xptuxyemaqgzooret/sowt4qln4iskvwtclhvueeaz0k1mwcolnljmoutgp2rmk2vegnoq5nsluuwyxsvfk3x8dvql0nprdomovk4jqvyriu5x44qs6irodpwvar0pkos6tabovcrvcry916k0i62x+0c8c+9xdwurpf1s7twpxmmpys35jrg5ulw4dyrelmpo3rxcawg/cezpl/ohmlpy5y6pehvao86dcepbxl34+qrejvcved4o4mzrsslomed2ux+j3qlk2j4plupmkr8zrwhjohro5ka+k2nt6z2mfvno18nioa21xfuxfx4x2w7yuokmppbnh9zukkq7pn+qsbfqdp4xzg2kp3mygaxbzjaxjtqt1xi8aqu1qkis9w+r1vk9vsxwmvrww4e57blagajhs7baffcycj6fhmp1pgtdaqaadoiuyyvw38n/2rxvoetbwfumnj1vk01nuc8ereoberaberaberabb9ewxi7jw7w1bbexwid5htdnyps43ts3ofvubluvlrkv2fhk7k0nhllkm4l4zmsjpj6cijje6hgtzpvoqoyxu2saaafgnab06kqy9wfxryrs1m7gzs4wtprhfzfmfqszwggqbllzqb3jr67t1bw1rrrk4vkle4rnhtjzrhughmhhzc3vjg5ddz1j9643xbg8lnni10raxz3gj+7xnvyk7iqtrxbgrauf0tjln8zhi1w4bk1a3lpty+hyz/ubbxffrjs48focqxiv1vm+j743tlxsni0/x5kyuhttwucq04vd5pfh4+pmqphx7xnyd1dpqssdmloex/rmpxk5p5fwcbpqzncv4s2z6wi4zaltxma0nr7dortxoho7rcrg6mbtmy/nhmvyro075du8yciiuac0qbsoixn7lkqfilyrprkwls5vkkgpjfldmknn1vzvo6ekjy5bwbwo4wv0obr4umpcuobxrtzuksjqfk7x9q+j+ck8uoknzthginpkdyh4l53oqv0skcbdxspdb7tv9a+nsdwykonijgpiy1ot4dw/xvdqdtsj3l1mskt7egpnadmrx1pkswa2ggssho6n8espwexllkon1gv7igkdcryxaf/x7lpstralnbu53qt9u6bvmoxywhyasyayt125ghbxbylgey5rlqavr92gq/c2wcqk426uhvqau3ytqtnnjhtlhwba9vqyc+yerua4z4zc8umzpllhzzneuk6k8lbqmatdonw17vpsttysatswz5ymw8tvyi3b+skmanbkl27/ob9oc6jxnwmjgxr2a69xyhkvfjuezld/k3xassfmlrkhuadskk3hledtu8ig5bcxhjexn2ulxtcrbho0+jo5k00ly3a3uy3tuea0adztwvwu6lbxehywxmtsvbe/y9flojyabta+fisttvsp5imsg0gbmbtnfw9lui1t9yfjmecc3ubu0ntlw2utzjmidyqq9or/ecsxwhmmpgewjkba/grzic8ta3db6t1ns4xlzc962hf1posrbcm5jti0976k65ofrc9lbe0dywxgelprr53jtwribgyhhyi5gw9r+iv7l0bixdhuusrld5o7sp9ic9h56j2rk2fyx/fzwuu8ztaynbtvqv2+kxhs/ak5bqkltrxqwe/6gpcgui4sx7zwkk4aszgatsqmepk2q5fk+ixgrqaclokkugczui4scx2ljqqw1gktsfdsbqpkngrixj3aprirlldrukywnsftgyy8keglbzsjx13eng5iapo/7v9gckyyikecnosgsf/0ilk/ffp8aw9t56mmar60zfrv9i+l6flgfnx0syjh4m50ucujs+bsxgcchndgrytibbhqjmuu8ceiltc6ow8ny43mld6rxhrgfmnwxwglvxt6fadkwymtzjq5platsqiwmkidfi05xmec1wn9iftwoayb+nl2j0rcisqyvlbagz07csqb+vzb1hexjfp7qovtpvtdddz3mk+/dxk/fmvasxby7fb/vcoeen2q5knah5ac1osislzfiww4f9snd96xheutpss2rnl3q32azqls9w3bmp7g74tx40lthkyu0cxjmbtymzcrodyogxx6l0iyfkloqpk7xo6ocezt0zc1wqcbi5rst8vjuygvln5bhxubcvmcldddpp3cunnv+rjsujutlwdg4r43pi4xdnoyokec1kczvrbdx5bcazo7mxwu7ohkc/xzozalab+sv01qwh+rhctuqcdlbx5jlt0yffnn89+46tdzng7lr8burjg6cuza8xtbk2xa9vgsykqbo45ibodzpctkv5818+opznaiss7b29f9lcdwnjp4whtggdp0wbdw6pnjdzut7lzi21xg1m2g1uylxiinn1xs1cg9cea5jxlqkvcxayodmzmc95libhl7l9c4nlixaooctbjvoyjuxaxti52opczbpqphd6s/ep7oi+jvzhqwhiehrxmofwrzg3u2wo4zrrkjpnzrl9vvro6g211oyxgoguy5llkmvbqjz3adft2nkfcu+8hyoi2zjvzv1blmxbvpmny3vze5466uhw32rs2drzy2j3/es6tpvpboafdpbcs2skmot7v7brezv4+swkm75zvx5hffssxs1hzt2jjmjj/hc5bdigucsllrsapg2/wav2njl7i3pnidrl0b2dbiwpwxcql5zunue3h0vu1bcwgu4pkllsrjik2ykab11i9u2w6lutngcnjt4hovejlaouv42visk1n4rmtdztyqler+oa1bo9rvr843up4bwn5vmgkd1ovl5eauvreemvugihybft6zt29as38g08/fv3cxhlsy27nzhqtozhhfrqr4nuaadnf7j/dslidwl0v9hi92+bwppps03b0wpbvosslb7hl39vnzhuwgtynlutiwqn4fvxa1w8gkutsesrjydxscxg2dcr4kxy3liapdpmsf0l1avu4iztmsqruvblehefgapcqcvsvq5yqckueqxkvcc5y8jke0uyk61sy2e5wvno6yzromuqhlvtv3wdup3wqq32vao9jyt48gsrh626q3lbyeqtspubk+qxhkwdn5z0fkgmkrlogfsvx0laxsvbrn0em13bvg124uwj9ovu/utoiwot6xc4jzaxiyjo73/ai962ldgdz3vvxvadkhoc5sqsykdqw3jgrqxhtjgfzwdkldafvrxkwbdnupzr9p5lmpdui9m8u3cnefvrcc4kdnvob77xwnxg4z9huucshkzangxmbpyuabxcpqxoul+jzjfyexkoyclwmyglfrzadzdqlrnmksjljl15up1ke1im8szc5jb6tqk28svta11xl1jroubddb71sphpvk2fphzrqeyufadisphueg2+hnwl2b8nirki2hp1ilenuw6da0bvtxzcv/1tgv9f/gc4s42a3xxz8s/1rgn9d/gcswf8+jm9x/o5/d6ojkii6m4qiiiaiiiaiiialy69raberaberaberaeg4kpi+tgttheq+wlswxkprwb8rfpcie2d01xvgshqms1sew7houurbpm2eovcuuqbtgbjnqi6ed5fktg6z9rhlpzcjve5opopj897qycd4+zzxu7xfk4ndnb5z/2khrdsklpwy+5xnwrunatpjxhb4herabjheraberaberayciiawbrhtem09xe95sw3y93qebnw1xamubainwdqv89rsfbve6ajilhqy8wb6qhnzhuqxft4hs9aufvuh71+zi1znmaxrnocgta0lzjpyw3v0lc1484nbj/oslszwm80jtot9afas+hrdwelg5exubak5y+c82qutqdji95e52z5ic4lxtfzwerdnfjlcoaljyewzetdk9jy3tvdgz1ynojapilhrejjcbktlywiilgheraberaberaberad4+h2lupdts2slp3nonzgee3iigok4cun+jaqjp5yynipo6fpwyzupqztuvi3og1dndw819cbovlqnyhxzsrf7e0mrm6zyxce9m2yxou5teirj1vwttplm2l7ytiodhnpcp5xbj43wlzg1pnnn16nkpb2gubcxiubfw3wywpsntejlalg4pvlmnljcqohuzmcw9jcfpqd+nfywnrchc+9qhsv0gyg2wqaxrswhzlntg++ouuxr2aaoxych1ouzxu3hzciitfaiiiaiiia5rvbrfwbwdvyrwli9fxbq5ufve+1wy5my8tuvgq89wnkniosu9yqide4k8c1w72iubebxwoa9svdusqkpzi9jallzg1o8sdgmt4wrusvbofrlguay1dm3exdjh55gp9i7fqwfpvlv4fjdrzhxcmwrrxac7r3uv383e+1tcgidex63v9awattxauo2vhwqah8y+14g+h6k8jabqbrhs3yt5rdr6wrtjzx8/jgvbfpywmfx+onifli/iymxc77aozkghamlsv8tzwsxdxsnhgj5mjbryepe1xnup+lpk2dza+0elsrgc9no5vpxwxwfrzhzp6gbrhz0g7vw/s1apssqvvp4vrmxmtvhyjslmei8imjvq5ezlq965blliokkx37eare9wc5kivixtadorsre1k36iwvje/mrboyvlgtriiacywai2ts41xoq2mrnz5ef9l1njkimhzf3ezanxjq5xkn7+f7f1vsjovnertvwu3jrdjrdgaki68fcqrke1uevk/lxw37jl95ukcpcwtahazg4t6e3kr+nsutcahuht3lvimt1ot9b8/nx5627mpbe2x+9vp0/xuolqnt1hcriiutdxdcfevzq57tmxsdx+ximgqnyg6gm7tbezpjzeuhhgtm1orj9ghntnxzvyrps7cgtotwr8nncgcz96umcg7nsb13k2ufqh5iivm2pj4jlspojkwfpvldjxwrhrgll295g05jl9jpu6h0fum6hfde12gl3ei7pn+vi9dgphto08dyunv23uetz04jhhmunmzayq/syx3wufclhpbb/ptdtmicirv13tpztop2hfx0cv5+8ygqsfunv0k6z8jx7usxsmuqvsuvq6udfbhr3wwnuv7k5vqsseqweslguhnw0w6ojpu/avoiiggxbvr1fmrb29sm+8n9i75rjqllud63usn/p0cw2fnszaf64r0lhqjlao4rzitx1jdyksdxozcaoptsvmumi0djudh0/f10b0s492kkdk12g/ks+/qfc/ldoi3+h2+iurlv+rvvzpnqxytuot/cvy2w1o5xmvxavu48yjksydveeh3k44lyyja3flttiqqcobg4l2zm29vif64kkraiybh6k48ivdwgusp3pswhtnopmd3xyjkrsc74qyybc3/apzpny7tldpo4c7dbxhnhpjoykupj06aclgnjdc/viyzzwzvri18kdgb2c0ovve/nd9wca0br4l5ylni143dgfjuu34tjafpg8hv7agfpw3i8fzxwk3utnjpywmutp404mbbe5pd3ncwa3hj4lhtbuz3fxfr+qzoov1velctm0xgbm1mgd9j3mnqtbhdmuaddyf2qc2pkc1pkfct/wdxxkimekabkgfhzdmrsdbdbtulmpmrixz5jrlg5ffkaobtqayszoijbu5zrc6hyd2lspa2apqpfluzthhg0r0kl7zjebyhnu+ovmylnjfhm+w6klfns2vdpd2r7e73yi+yyslztdxjrewu4jgsstslqamos31r09vjvdmori9xvcjdxx/e5g1k7mzdddy00zog18atoiw8zf4kog21hftkneiwperx3dxniyoa8vckukzizctotfazvznkbe8lwxgqixyuaw2i5a9sd9rxdmy43grn1ehu1w+hqny6eumayywuhvwi+sz0sduuk4thvxbztvfjgq57w9rcudz3elxcxfn4q905vytuq8z4xsg1qvilc0kwxhi8vfvnbv6ck13hqa6efgq4g3zm2338lqyzftjl4j16oqor8hbgo88wzcmjm8ru+f4cygjrgjqbk7l3nxk576lkbscqfbvp1cfbsv1m1giznpljtl+rkssgih8syox7hslbhwxba6ifpo+mnlz2myhllv1x0pxtzaqenwccwoc6abshylsdr2vfmoalw5vgb8itew/j0dvvihnbg7nr9tdd8y0fa/dd9o1wdtkjqrplwaaandqna1oaab0tyuaxrbgdnylndrboen4+xbfh1onabg1jyos6v0mvcmqkxld/z7tvxowzgtczq2kzoytulosqrmol26thvxt8lbb7dukrwuvtzkzfusouvpzl46rwc9isxievkxpjfvi9y26a2wiqlcrlrkqsy2dqcon1h3evdpsmtexow8u9+xymbe5uaxcrusb71kmvei2w5lq0tusfh7vrujy2n/p0nwzsti4q49zuegolwob3y/5g3gux9ypsaxjuuquqjxfzmsnp1+p7ss6np0a005ljlwwdrahqsmao84208yvsci4dmmlsinbmwcryhyucprbbpwvbulpzsccwzn3joxo9bxtvdbeorqwancq3yoajc7wa37vdrcwzywta0nsd+cfhqqowajumxi1jslhpzz+ju8yoio2fxcwmlzzhkuoljiaouwni7zutfwss3sxadckaz04y0vo50jsbadlql4jgxagacm6/2irnnppgcg86dgnntsbkaut0vdi27r8gc78e9jdnoiu0wgeetgper3y5wswzoxl1wvdgl69bewdf4rg+cpjzlpmohwxufynsgau1c9y23l7/ani7nxn/aokyh/qj9ql59mk7119avn+psd/ob+ofzs/58tn6v/rz+h1rherf0rwgreqareqareqareqareqareqarejqb0j0a4zzk1qrbtdkzf6i5qfknccxltfddwn7uahix2w/qalsbxpe4na0xc87adsuauzovwxvo+6fbu7ac9mfmxsuc8ucqvvjm+fkzxmkbmy53ekze+l/qvffhg0kcozszruywamqap7x5aqb1vu+v7nypl3u1c92/l4k7z2bzrmljymjqnvi48oi3qt5xh+zalr6k3j1jpm9sv4ilyozciibaiigaiigaiigaiigatph3enrtsdhfnka83tyeg9wnktwibkezlelkftqtpvvb4fsm+bg6l4idvyub3axfycihqiuee5yn95t+8iijwwiiiaiiiaiiiaiiiaiiiaiiialeynxxpsmdhhkc1xzaphqu6haneydom1isyislvnslqg8mz58cqxlznvchlt7oihkbywaijywjhhctqsn95tnhuvwdi1zjmolc55kywufhzjpmkkioeyrrjuwjetvczos1qz9c3wdjfb2me0nnjheedtfysi4grtagoqecxay02lrjzodyvooy1jrsvxamljkbg67g2a3dvkr6e1nkukdlprczunkeh+s+jpnvlixe3lixopit+1eii3eshjt53ciqmrlxdqllxdwjqsdkmesmdvubteyejr8nqta6hkt9gehwvt7px0u8wasffr1bzaymma4enls4svpq2b0cg80xe5z3es9xc7zj6ktqqota7lh+zcu6myrjlprnbrhbbrevkpho6vunpufhosarpy3m1zobe8pvwa7tq7rgfmeiopsrbmksouwcyzmk05qy3kxiexovgmqrtmriivohqyq9fknxo8wf0svbewbf6p/otyunpav0j2sa27nodwthw6+gugmhbt08cyabgxcerrakrpva2iglcsv2vlvlw+f9sqyvs5bf3h7qt2jfgurldvv48fkpkt4+cyo7iuvhqkutzhyxp8a0i44ykawzrocozz4e8/ddtqv9gtlxb/spipkmjivoy7yppyfaqsjhxus+iyplrtcie4vsdtuqrb9rk1p9rtsvqcmagtaggaab5al569htpnxca2ui8zz7g6l6ca7qll9iqmakyesz8xlnh1g/nmqxqzjirzerd5fzirdust89vfyz6yx7zbdqvqfbeosdpgnplusyrlmnabg9xzvsnytyouqzipyzzxopcbgjwun9ibzfhufbgld3hpj+sadwr/pi6nop52zisvgxqju8f0xnnk/m02hv5lmnhsgn1jlnh5pnh7quyyrhpyxoy8kmbvlg7jbmopwcdvedi6amrv8mfwhgdzw10y7pwpefkwhzv8aqqvkwzjkzqcglkf207vjrtp960kmepa9rslf2zeftc6thvvwn7gwxznnrr32dg+ljzwfj3bzq2mexcgojgsgfg88wqrkeqolptuwk+6esktaxlujln7kujily5tm6zb7rcbsolmwgw0hhbdtx95krxateubf5t7e9sgq4tyidg1nzoclsc7mbbeqz9qhfbpoe64q37lq3xg5hsswbotybzrz8zywzjks1xgpao87l5bv1gbzqvikhcgalplscvnfkrfagpmwghny7htfxwjqut0voxat1gi+mm1hp1v6lxkseksdy8/afdjxc/rtzabn0t5wvbwfkzwszbbmq0nba++4cstznuthipf3xutjgqncwvleqtp3u7slhyjkp7tba6kwqokjzcxtgwg5zqs6+uvswwhpiunvkvi1hjcdjygsqsil6rovyto7qxzfioa0ke+kzgyu7uyc5t/c3nqjpxu9ilm0icf1solirfavuxk2hlxzlpoy8blboqpdykrzykjrnyqsxjlnrbc3wunaruysqnhl70bld4ojeiqlu+es30wa/h7v2unggxmprvb/o2e2kkjypig1/guqqtwtl1qsmdnrjooqj7pqxctbxdxikj7ybbrs4+wleyhdco9lmmzkyxg2dkrgplnb2apzi5trxcff43fy4vwyg6oqjpng/apnv0b6aksrfp4rwhrzgk7a0pehtupiyaktuttkwtvzs15mxudwtim8map7nvmvutktfvattr6k3gffl2ksxhmkvx2fzswc27wfg3w2vbmwk9k0cpp7fviodpi7jivfgvishxkspntltwxbh7tv8co9luqype6r0/gqyeoquksly1qodbrnmzmnyco5k+akoaya6sd2ccewnnemn8pbu4bwrjuyxrc3nerzyyzor1xbklawu0bpyg3lnhedp3rze48ttfzf/fql6kofoxyrhpjgef+e4yw6pdaxzgyojm0hgskjrb9q4bhztzc8tppggwgqikazuuqq5uvvgporlpsmjehyd0yfeyzfiw37wi1v71b+ifrljkkklo5mu+hmfnqymxepcxxdkxfpntadsqfkpgq/4j39vgbk6jz7cfpxvjwh7twmzwpbyuket6rwc1iy1xttujm802uxs1mmzx5ho52vqobpq1zzqmrbhuri8hhbbguhhvne8uyuqsb6xtd3thrrvhof8rqsowg/ufo+pifvrynis7snpzb7xfqkqanltbtcsl9sj1pdjqk/gsta6ogez7wen7aczxhzpcwxyxc5rszqcvpzwjxqyng87puwhja2wiotdrobmkx/apa3eica11rpg1s18vm6ipazk7phfzxkzcbvprtsh4tpikupri4nfkkkkukctlbf1gxuwvzinqorzhex5/5otlzbqtgmpfhsyjxu8lhptu0zagcqlfvni3zewutf6v29tutbmdw0sll790f3q+jahxxbpg7f2/ifavnrjwpmsty7fo97r/mtcwgehqjlrxnvumvhclyytu4rdzaquyoca0wa3rrftpvzudupe8mdb3dc+v1rywxn910r0u4cjkqv7m6bhal7ajkpaftxtzuqtl5bq+9qzpuhafjynnhyxt1spw0myighumm8sltcx2nil7j4kvwp0wtcevk0kyy8nr72ueqrmly786x8uypvuglkj+jduufwq2mspmyv45gcc06h2h+8l0g9j1apw/aijuncwy8orzhgcxgs2zfcvw/ifdk77csgf/js6vgztpduqnw/sb4eiunmywoiply+ftcu2sbtv6akue/vpnoqdpla1nb8dn7p8jozr0ylbeniqyvftmh0y8+vwnsqzms6xi9qrxe6tvkqwnpjzi2srjllej7q5glbwiw3nyldognjtck2nl0o1mlvd+6nyrccyjjljub8bkzrrgr5cdqrxfu+seaazjb9qik8jynkntzknffei2kv5leqhgwpnyfalvdsqwaalxaenmrwgtjj0cy5tzuzrqfdcuiiqpkyvngcsdmht3askdq0ki8frfrzk7gndektq7s2lzvnfxftnrclvabahutniyj/agtbhvktzvspmbwjs+l2ubaouf3n+bghtkl2rt+yae/jrz5+ioouppkctbyabgygadly6lipabsbdao6bdapad2qzu53ulfvbffa+nipyw079zqdtw8iiur7vegtdwbyx11vvb2reufdmzmcutbj7zmal+w24c39pwlfmhsze+g919ynuvuakehnytar0t+xvzyw9jpueptbu+c7jcqkmxsdymfpgxa0+/qox6rebwsilq6el1w3ngbsbbwrg8oyxqaojltiq4zhoznz9htue+6zhrl7hatu1wlhn6i2o+ksg3jjk4ncblf8/mfhlzclzci0ah41/yug8yeisphle+ihduqogyrgjtyzzbb5w6lnsv2udxnlslhzxahwcdsrywlcsksoyjxcxuxgu72/neyp9y38fitfque++bz+xsdc3iv9dvb/+i4d/waop7sl53koo+k+h5v9s4d/amop1arfn/pj++xm9x/o5/d6oj6ii6i4qiiiaiiiaiiiaiiiaiiiaiiialwr1xavhdjgghpjea0pvlvf53gkbwhusvb1rgqnc2auc0nlilnabty20kyukstzbts5iwuewtze+3fps3nbhdmkrr5mtdsozbgs29vmhqf0ku8h5n5linayshgoll6ui5lnasvwvv5ncxddvzvtyl3/ah+bz5zrkmwf9bn0a8aos8rf0aog5ciiaciiaciiaciiaciiaciiaciiaciiaciiaciveaeoiiaiq44nonmtlja+vojnutlqjiuo4reqiereaereaereaereaereavxyfrmuabfrg5p8qvt+iein1joi5gyim2dab3dzd8fputhti5kt5rlgtomhtt2fk9wretyi9avydunqdx6akd4pw42ij+xvepjahr0zdw47zup1ufy8tiini03a7ob7raynxhuvdgxyslzg65bafx6ui35qtxhunimxt38y7z1anlm5rml93yz5sxsvxj1tnjm8kl57rfot5ncwkrtxiorckk5ucnkxlciicnobsuyuv038uitsbps+rxehqq/i1owpe12jmult5g6/usengdrm82d4fo9fip5prvwyboipfpyt5gfdfvwvyu1k+u37z9o2a7vfsf1hcpqo4ggqxemvy9ntmbpi0vd9ijlomewosojfvgsaww3cb5kbfvfb6j8ip7f1ijibq6qezb55totngzcafrsvffb5rwr/co/e1fdtbtllnx4xj6q94vb12n/ky+wpujmkghlpv+m37lcoj6lc66wp6wnkcxd6piygogu2ykkq5u46pppetjejltdc5/6n+g9flt2+elxx9rwuu0dlfe/whwwbh2g5a1je61odryda21liyyldr1++y5+c3vm5m3mklfqiemzroqrmcgubj8eaupn9xtsrm9qa0ka23/amszhe1xeojinh71rc9/c3nfngnygz55zsb5nnl+inapgutekhes2cz2a2ydm0ejk4q5x7chmyvfs04gvetb0xs/0ur30yj8su2z9gul+jawlnp5rr8v12oxs/xzc11ze5furbtf/crkoerrkomipb8vkkjbslgd+nvvmhh8vshjot5kovafydp1skypgq+bxrgkrtede1zs71wkoophnsjoc62drhnmdr7lpaotm08kgymnp7ko3qbkhnqspnt26kzcylhtfrha3hflkafrb8z6jvn9ows3tbvg2qcnn+5zrarmyoueesfzne+r9r9mg+zh1lefm87uhks6rfwtbi61gpkuvjpdo7mswgdpknvui5upur2oe04gwps22ultbd5nortfcxxj1j0v0hqdfumata0a2c6ihtjggmoygznpftofvmlq2rkrdkxtlmmljcbk8rlmmnykgnqeaeo4326eru9xw3dibudbnrlbipktw3cqwsnzo0bkjc60l7d9go7hcyfk5zprvfzxyvynloelucjpcanki7oltln1hopeuhcg8ivhle85zmathewan03j5ls+ld2nfg0adbzzlphyrkuur1ksxcoyfzejbwhujgxqlsijtvefbwyixpz/hrx8dlaei11jonlzcsqo0wdvoryh90j3pcgvstcn2sa+zxxmg5dk4jpdnstsaucmzo8r0xgr/t+5dt0gpmg4+t+pzhwkekyl5ou3xqs51u51gtwxsdiiatkfsxqpb1v1qcthyk1jvuthybu0hksh5srwfuzqkmgmc/asnz7l7pjpcyx9cnrkkfq/o+ooyo6vttre0nzivr71owbarckumy0dqabexbcabznfz3fc6wq98lswkl9gv87ek/fblwmhzarmlipzifuhxxfmxqmrhhawv8f8o8qvrlramqm/5q2i17o2svowec3cfkqvnik/aehqaryj9wfexypjryymu2vtzldoqsvotuisqhrqvqll1iujusgwznwavtdsftwh1r4qth0cy3/e9wq4ld3d/y+5vvddyofdxv0fvluzkfgttnyfbexumgaxmcqrupdllhbh12drwk6d6mpr58od8qqoiimm8edgr2h+m4frxacrweowb9oy2lkjcjgalnb0b0kw7y6i/vjvjuxqnhg8jnpogdjyz5c35qpdht0z6dtygi6lrwnbcgd46k8/ilacjwccj78edy3snbe4jd4a0lup8vsoag+xhr7lwvucxuhjrzllpm0cw8vaptvbjxsmt/zv79leoofxdqqqjrcjaliko+vhqenrv9ofph4quw+iqm25c1ljrqhadcextkunyb4nr9yquvljnweamkuysdz1jy6/sxz/i9k8/lo6hzzozpic++3mavosqbdp5ffcqxckcamrgfwgyytoel/waldrr/avmxlpqp4msuegjnupa1wa1til5jtbwsuu+irdc2n7ut1lluhc8uxrcunw3jlex7ps5w6dndd34lpslpgwixadgbpodh8t7lo9wqj0ul3g7rc0+lvezenf8evr42gn2nfto4g8twptrpufqooqn9okltruzijfpdm42+uyuynwhzrqqdvp1i/iuw9ekvybefyrq4hsvvjh3cj+jpscrl5hukz8fqs/rb+qvvbpn3yw9wn+r9iujk/vmrhr7iokaljalx7phq/glsfa/g4s0en5tn/g32q/0uu6dxfdnszj61brrwkm1vhdeikmsqozv97+s1lms+qebwdykrsys89nbrecsfxghebqf4tyhk9e6wwukdcrkqx2cx4gxn0mlprcyzmtqao/ilqzh5btzw2xgpynoupwrw2njjeeablfys28dkdwxwm+khyn6klctxk21execpba/xunr6jiwlajhonlkqmvclswpavbcegw6ktds0wwbhq7fx7pow2dvirkkebaxiul/xbmp7wlw2b+vfq47dtqki1la4txrx/ls42iatmivzc7tgmhgkjjxg7soz20f1lp1ntwei9nt1sljzxrr2x5ma2nafrfdtzkvhogmlri19vyvfxfkvhh2a6x38gn4nfts8mcnb/s+db4lgo543zdkrcn5pttbcbwcrncxj3a925pznedus0/dtozlm0rnpljlb691p5dooqsttkjhtbpsceex0ejqmme6kpqr5qxovmcsnhpssj5g1habcbz7ka8zy6lhiprjtgi5fixae49vt4pxil7o5t8fbu86utmzbcfevusyy3v4ffxrdosfr23bwzdjdojloxfjdy4wa+xfnnpbwhtpirnnpdqwce2mj9naf2r719jzgf84+mqvemj5ab9haxh/sjjt8qp6p3ikp91npm2v46ox6lua7/jmvofn96ufuqkgxx0rn/qxaf+hh92f89vzsf9c1h+pcb/4cf3yvmy/nxm7rh9hp4fveerexrhbheraberaberaberaberaberabvwszxmn7wcdf273vcjhwknh5o5ypxtkgjdfl3fnee+65fxhvysvmxkchfrixpfrzl6alnwfiima2ga4jaqwtm9cg+x6hx+k6mimf2surxk4dogtvg/xvyky7ei6nz5xpc3726jdwqxjjrlz5i9r0wkdlmziha/asxt5k1mwncqhh4bshtvy+icokltw85yylaxjg/mere4aexo3f9fdx3xvu2w5ybwaetreg9l80mdxexqiileciiaciiaciiaciiaciiaciiaciiaciialku7mhmx5y4abzty7bkgnmdsdz9pxijmc5emberkiereaereaereaereaereaereaerexqb6eraeaereaereaad0guhz1lnzbnmajwnqdnfefrtdxne8ofsn0jgskcoy6zid5eqy+kpe2yttjgogzklvz8xjhsvb2kathdc3bavbg5c4r6tlhiphgt7agft0cucmeaadrkhjaglvwcftvmwrnfviigfmsf3f2iot6o+ixwugcse1gywzx3ug6ehmcflhtrpull05omfmwkvtrwqfymwppgg5e50p6yolvgtbiuktatkyapzqtpx1yacsbkevurp3ehrhojfbuvmvlmtn7yfznw2tkcvncmj+eqc5rwnzhzfyxpg1sjb8naxjwsabbyafeqihomuuaafbzsamha0xoizly2zstzlgpc3ltoyw1fiq336g/j4rhdvkmwtnfc69pususxhfbdzlllpdfw/svqtfidspicw/jyryuhradgzsrsdzutjaa3osekevuyyr7kyo+olnjipbxbwdrvskbmtg32br4rctoaksxxmq5nrqyzofrybon8co+k6p2wahqfcut+j91jn5txs4dezjt80faux6vhnw2a1n/krmh5ovwv5oj5a+9y8bllma5rhkwi6h23uplvanixegx005zkomzaxp0u4iwaw3a4w6+x3qjcwdtzqseju3mjh7baep9pbsqrpc3+w42wtm4toyymycnqaff1uppxfyfdhzpfrcvgsya69ffcz1zlijcynoxyuz1gy1wxce1ucqvsqulkwlldtitedxwv+okdrcnfbr7bzvndcxeuisd6op1lxroi5zt7ekvhznvhtgnvtc8ad4lehhslq+0cxvzp3lpyblbunhvjjvlwdrr+nlh62oloxzyghh2fnrp4jopa+k5n/asws7nrslnzhro+d5qoo/vblwpg0a+yuxnvlevlwiyxyhzrsfhsuwsy8ilfbpctqc85aokyy+3msmervuupbivm72bz6rbxxnswctvmjkjpjcwzlrcex/fui4jjnk6keen3rnkjj63n7gctwu2sby3vy9p2lnnpewiz21tsah2jez52ydqjqtloddqrud/vfuxuruddntxyhdcqxvuvzkevy3lrznnpcvtv5uytxhezvslbax7vbynkvop76jsbmtszy3uqcwpwq9pjqskek2ausqldtfzfs3afdrawkhzbvez5dzlyndvwuz+roxf6dzssilvq7l6kqgjsaqnvxr32cxhsbqtwsglzuafhwirpjlia9puw2zaw5h2r5nxag7kpqi7w7orzdorcg2ub42v7v9ivkuzzvpkpzz+pwxf/spshlaxd/brryohilt2/5yvzpnxny4ewiu44gmqyj1jbqsm6xlliydf1vj9jokxcbc6xmg5jr7yv6wjxlu8cywxmbv3vak9ju62emspddwhrxhbkynxxv+qd0qst9uh3kjxx7lz1fhmkiadnssafivh3razusmkbi6n/0htf7j+xuc+oyvfer9f4ztmbdggkgzrci3rx7w+byhw33qi8nyx2seb2ouhnbhu2unhrqbb3jcvgouhyas4npzpxslrk6hl0aogwtkjas7wx28ffbeohd2ka2b3t06lwyjidla3jtbwco9tprlrbfbdbf5k6swzxe/ok2mazr5lqpokbrzcl+9bx/ill4t7isrecnb7f5gbl3s+pvnzuxjdtv7xh2prsqrqlvnvj0xtkqoelhcq4opzs1j5ntjhn1l2g912s2r3uc6uvq8vwwtsmbgc0kfztzan7x5bbpjprlpbgkpy0s4ziobongdur7tcxogmt6r8fmcexcohy2oamec0wzk0f7ldc4b+2ylnngucrjbgg3gww2y32c2dwaksrduauwtvxhymjt4ne+opj48ojdne5jc1nwu31iffcnonu5bgzm4dqrjblm16x02u6xf2wmkdft9qjfwy4a7mxw9xnrfup7al0e/8aimtp4fszsmeqtpibnhlc0oufhylfovcw6rzg8swy2fvve380uz9v+jza1+ensvv0xaj2g/5vselt72svjyk0ftlhma5p+c0t+h/pvl1nhjxkplsr1ikcxf8py55q0dpjbb1q6/uvjlac3upsegct3qdm8m8x71egctc+wlvavrtgpx7o8wr0jqqyhps8gu+rj2xsbtctsftfdzkumg++3ikvziw4ryxrgq35dzztqaceqvzafgfr8rqlambud057crm3hcgtqxmas3ifbeomnahikxruoal81ridtkaddsm8bsstetqnhg0unvwz2qfuyfrrh8zkzmzmgdolm93nqpnu00oylx5rybqgcnecmptro3cdhk3jxhvdlne8sru7qqltcll3mcpcwaew3h7ffuf8ru0xoorpvpvnq+sk7t8fkuoitiz1k0uoxncnwnw/wfdfzprufply6kk6de2vmd/grmmvibknoqxdcdtnfqpyzma+sswsa6ajvwtmitqvqazxisxizsnzozhln0k3ns0exa8cte9ugwaiwrsxe697yebcinyxktwkl/dulse3lm99wfmdvvrdloyhfoulnfk2btmyw7j5aymxyejd13xr+hek45/ybnbsrr3oz9y6qplncxeowmqbdsh3xz7ctkxvbu06k54he2zdomtgqmuvjk+avsvhmsojtypblkm0kumtia0ai/uw+pfszehwj4r4whxcb0mrbh1oph60b7aob+ts05axlg0mshye0axv+npybe7bhbhgmdlpaisnmjs6i+ovzet29qvjztbrfpfy6bx9w2sloecmoybnou/vx+psc/op8axz/sku8adsvopeg2wjaxtaefqbwrjyrxmvrg9pp4fvearexrnbheraberaberaberaberaberaberabaergaciiaciiaciiaciiaciiaciiaciiapf6iiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiajvhuhgkpe63cmajwnncnvi/mcopkw9bbsfjdi/5bi3jd2uuvxghegr1z67+q2gg2uudc7rmqckquyz5spsp41trg6t6hcsdkipgvpnfnb4vafuxw5zrc1824birqwognb/s5axdqy+ok+gtvnky17ddr2b7d+arcfwsrqfpe9xmadm9ucero8drc97ig6wcbv/rhk69oace39gxkvcxsspo+w8bdbojitv8ajxwazubwsi2dleaatyv2v4dsbecsiqea9efmjueyk+n8sqjii1b81df+ev1qkphuvtrfxbp9yvchpdzqviquebxuozwf2vgoal9vjzpuuueklebqpf9zxcme/x4ap0y6pqiz0xcvi5ppixfzju4lx96xyrrgra6dgdezkmfalqtlfbqny6lpurvyn2n6lmfar70w8gn4rpua2a16/tk5tqy/jv4g5zfykbcilljawjgw9padvyfkaefot5ldmwzipgojvuzyggnqsy3q21ftwpbuzhojc53ip2lnbakqfxpnp6az9nzhmbazj0zhrxlcinqbennjiyctodp8jslizrhduugh1egu6mq+dihg9tgaqkzdza4melza73228afths1t0p7jk03gyjakad5whn9g5q0wvd6jbd6tvrawzq4gbyuu49xa+4clt2uofuqc0apt4rew42vsmedv0ugg+zxzo6n6h0w0hpw3ck52ggygw+i0irjfyrdkcpfwck6drzdwhqtvuyi2ls+y8gpxotbnikjzoco6d7smvbqnt+89xnhsfbvqypywhvd7kforqs47n8wvlwkm51pvxmmwrdxsqvqpyrlccgj2yjhhgibsccoazpjcdq0b/upygrjhpixv37oga6uzwadx3cevs6hjv0vjzia9bw45jtgumanmlyblp7vio2hmbex2lrhhoa+o2eblps5j2qasjg5n/qud6tnroun5ws2gewdfu6rtcuyq2opph2re9rs+k2j84hi+9sec/k/1e9e5oe58ngq9ks6c1ndikpfti4vufnmjicqdcncphovxcpx6q+hvk1t2jg2iqbvbbzr795qibtzeh29anamqke5ylan4cnb9jpa6wurtsxg/u+9wa+/przbnb+pcpio46fesrghbplfzeclshpavpipvhv8aqx0nttdqpd7lzn0zyd2mlxufny/lhe7qh2fwuko0czxpxjuxbg3qnhwqsi+xu/iy9u+61txuzgk9bqvlyo1k0gk1ic9syprauhh49e17sm4rabnhfe1z5ncffcf9j0ztwta03lkenr/b2z5t7nn966ri2kmp4pjpdyn2an3o5maod1wbgmrfuzyzptnkdrbywfgb5aak30s3norkv2495devekodza8fcvyi1qtvd9aaus+6mzn5kwarjafzhbosgbopluej2y8fsv6vjnrkzvyay7g63v2f1svwcwsohduajilfzua1oxshv1jvyqtllpmsqyso7x6kqo/jwjn85wa9uwxtguxz96neibe90ejrnec0z6o5i67hhts14v2gnlyv0ngtlpfc24ylsukbpk5gxwa54jbp6txfr4rw8qvr2xexpy5shvpnzae8whlcxw7paw7wnrr8fg9sujnkeebgtkyeuebc7mdhsts/cjtxwfl7jufmacigbyy+vreritxc1k/vib2kuaquqea9sxfihhvpxv0rxgspfyczoqrrzy6rifeplyvpwtvqpj5pjyvvdjfqnb8b2ga2ucfa8vco45tw5v0gw+8bqtpynxz+5rt7scqdwtg0qnxw+xltgg1f2i+/mhr0kuvounvri5mksjeroce0xnvass+sxmfesxsxsbqrqsnf+umb1ahe53/+y2a08by1i6pa9n/be/8a2rciqdmrvv67ciiiiyi8yp78q/mv/wbx+5akols63ff7t2sp50f+m/etw9tmtxcwh9pd3hnhvni7ql2njcrhcrtsqmi/garymtope/kc4+xyeuwzxcvfqdmnuqv6nthybliywl0xz3bsbfkfgq+uyptyc3eizwfgttbdrdnnvswrvau5srgisfddvcdfxlsyhsnll2gn7ovjr2f8rv0sp/djp5fjvczq5la23/gqmuc13aqxpvq5uv5p0hofq+kzb6ogpi7n0quhkfsg/wdix5/kb5ruu/mcvoyo67kbk0x3t2lvg6wg4+d9l1utoxawwpanzrftkswwpu306almj3soeppkswv3q309c2ssjyzi3itimxie6mu1lwhq+jc0r6wamh7kjkwahzqa4u8spnvwzjp83dxhwwsq6xs4zwvrybqtjf5jsjhm/wccpsxhiw01arflfiyo/wbm/x530suqryb2o8wryjzbxyzh1ferlhnjs5wddl+f11/gniswfwppnxbta55/8zp1iqyi9jklyzntlv8m1j2i6svvlurenshi49o6eauscmzkomeq4/4hbieilbmqiregxk7/ape88wv804ttvje6krjo3xuifg64icf9mkxc5z6rvrw3eggaeblxe3uu0dzmj/zvpxovptnoehwmklje04tw9rgssnvl1nd27wx0dxndkw7cw/rjsf7dvxhg8mcubhkwsc0lj43aeohky7rxof8aq8n8nfqbafjju7s7ymjrmcdon55/qgyii6k88ciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaovtrbug1tv5qzzzmzf/ah9qxnfylr6omuoo3guv+jjfe2p3qun3qbfoe/8atcfclvo7xyqvsbxosycgenlc6tj9o+kqxdpxtzbtkmmp7ztmuahtvosxpvzcrfqyg65pvc2vluw42x3fllrm/h2qtkhkyybdzggnlixnr87ar3nykuq28lhvnqadycurbmbi1ya0+5cs49r88zygbiiznfpnl7h8v0filfwxtkkj0y248xcgfxkpmmj3vcbl7i4+/zx7ci5t1vhfur3trrgoluyzlbv0q2atvmws7gaxnkb9ko/xxwkaaaaafjqvypgf/wdpof7zo3j4x+xdkzzrb625abnzxidb2r480jbsx/cek7wdxhk1quqme+xlrgpo7u9p5jsuhjljz2angpdqt1ft2wfosjsus1ksrg0+hnhzb8zmust1jwypqcc+ivxqq/dhuq8pt8kmp5k42wa8fvwoaw73e+h1lynbofra6olhkfsacpx7ve6c0q2/krxy3sxy5rr5lflqbramrqpnlut4qsbm1p0lu1kuf5imhs8zczvrwc7nw8p2lsz4457srblh0jv7bywoinooz3epu/yfdbrgkeesoxvz1w87imuyovxqk6k3j3jwxhtoacospp7laacdcxbzcpoxi17my2mddw+cuc30h8fgsyenda/tpxwfv04ang4fo5vrrgkk+rmz7m9jc+dukjzlw1bzzmcpynpsxuflnvas8sgwmg5hk9ydq1y5xxrextq57pvmhaghce7hdf0siqdwtznkm3qsapprzjl6pku94ye8z1fjdug1a2v1/yvnrbeih0szxtswkgsnivdl9x0k+g8llzixkjchne0oa7qcosq9dt3cqqnz/ulsa2uiovlgw2p2/akvirjwqosxp5loslcayh8qpjwbt5gflytzzjkppb2rgp4/9r6gngi4dxjhxyesmag2zke2j6zsdvybhdx6pxovki/evzmnqvliovcafikvceffkaqgo12toet9ehzrslr/aki8htg+dzdzxzwk/rb3w/dvnfpbngowlhxkqzwt2dzwinynfhzz8z1rc2wve71rgtmmgtj6pzndx1ay0n8bljkhpfbxitjaymu6ksy2jlut7/naihxuj9khfhyencxjvyk944xzat3n+y/xxa4hajx2/arvcippuxfyhrz04s950hjtiq1mpax14yiwxfpnn9zd1vy8ffghbwdaz5gxvjj7rslxdvzx/qces1mxlc5rm5xnja5p3bb2k6yjsp0ykeeezspocm2hvssdjc43k9sxhvztrzsy1v2czwencrxhrqnswnklbcdv64rxo9pspfycolyq2vqafjw6jqbjp7rbgpg3vuvtlq6wxk8lgqpyjmgctuy+hszjwe6brt/txwmdxtzlwfpz8lyux7rnwzhxxd113n5hmfz/afc0c8ngnzxmaeyy4z3xgsvhywvwopjih6rgi6lhgjggj0pzmupzsuoxz9h2lnqmti7uaubyegc9if9d0jcoy8gnpcupvqphnjrz/itv5xklplovrmrzlaynvns5skymlwmbkk4qdob9u6xziirk9xjgvgm4srzgeqkut9yl1rbiy3wbqb/+l5zxhfuzuyygtcqxand4bdxvyc1eju4uhz2hxazm53sszfxka2cg5dstbppyqh1miljqudi89tlbtdfl4ku9uiuwndetbaxxgtuqbkslng+66j/xng733b9b1vqvbdfeyp4powoee2l52bvimjtqpafkyfdybamlhljdovnmxcuegojf9b7xh3rdkfswix6purbusmaon30mmp8a2onvdjdww6zereubeadiimjedwpucwn22p2fatewgedbqo+cmoiunaron7dm4p8a+06ffrgrp3ym9rwfvdzuuz6s3k1j8tzvr6ub6xwf4gtl/aq3ywgu/ikt0by/nzj8b5kxe5ufyteylh7nsblanmqycojpsruuvilhqdfqck4vll3nfldzivezashlorhykwtur2rj5v48k64lhldukyr3zra5y33bvqsyak/qud2e3qg+4knvt7krbcgzzagj6bd8df71rulqgzq/r2q6v3dhfb5k9ik8dt1k5vcsoakxb35gdoqmvgxq+ryp0t0kyt0emuod0zdjfw+3wwjnttzvtn7asqxtui99rbeasfwpirslyq8zxsdw22b9pwo8hztuexktg5m/mndyr4hry90b/co5rluwqjhsmkilbvqtjy27ro5+nleixzs+vwdlldma090h9t7+ck8kfu6fn3wtmwmikfkxmj1c2whutjpbcjvbxm3b7plpz8/1oi8hcrcpjs42mi7krdnejgpftcorciixcogqgttkdw+pjg03l233tzsuz4xxnmyyrjg4pahajoqommmc1f23hvhjg3sblddgcnfhnkwrhkpytpzmzkl5rz/jz0etqykmnyw1kxea/zs1vmp8dncrvernndsj7vnzyzcjyz814ymw94knsrlhrt0ij8hrfpp/afqthpmvcrmnrss2m/h9uc8rexwhnyreqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqbyuomussybvfelaz6oulxriccdyjuo6g+4qrxny7g77wrxf8tpmuc78rdaozvjbr9vgyl8tv84ckcsooahsou5ju5nh9jngoo3c+imoxgkejksugkjelhw8tiorwbd23hzyuga9gt4kfabbjqnvbllvp9qalby0lrp4qo35eqiuyz2udxrewta4ucghouxhydqvlv9bbmsqabcuplxj5ljnf3e5qxgomkqtorv5r19/jtulevwwowtwrgjhpc1/evedqp9mkifh7jfph6blosfwvsvvqpqc0oxzzcm2y05uk65wie2qi2vc1si6unc42bfklulxa/xxfz4iwwghtp5axsvngpqg8wbj719hco1aqkwnm1vjc0g9/wvzxhxufcx6qu3hrvxu/q07cps4m3p6cant0h1loyxwomwsogh1lkyfyt3zalirjcutctnv0nktbg2xl/frfjqz0umc7t/bvdh/akb/bzse4g5t7lqujqavfjuraelmzrbj1hqb8fztpaaszpzfi8stoz0um/kc618jd38i76i6rau7xclwyfhb44w0xeeulstvcpdzbmion3f4naes0rmpft4exoz23n5snglwst+ha6jzbxlna4c5aaphrx5k0awa10jvzbp71jnty2k8m87feubg4v4qupawbpngr1t9awpjvpvz0ci8lvd79h7lghh4vn5aiwq+jnvy3yj6hhmuvzblplmutfyxo3vno36roywr3zq0dnlq5t4oxu3jzxyabibivuhmk4moanawodhy306lhpg0rrvyr2i7jrwd7x713mcclxj0qyflnhma/hwzhfpd/wbra6dnkvpfdphvkl9hvsiozg+k6r6kejwqakr+rbvp3o6fojh1j2rknlfpkp8ujji3zxxud2uhigrql20jc0xsfw9jmy3n4u8n1kwqsdwuc4s4jbw00cosherkz6l7ai3rsrgpxfqvoatkvkbhjbry2cprklcznfzj0h4n28dpgnvltavbbd0fzm/b710t7nov46kmy1wwwk9tk1rs0gsor3ni1abuvb6fvntrkuflobocnbxz87xsuc5rwt1e4nhmf/a+peemmeeemyhqmad523xz/waj4xhlirgro7sgov0rxwi7gnxcctwf9oydfzoxaxutu4x+jstokfnvz2+rmlafga9sthuc8ndwlznhyna1jpjboolscei4h6yokcrrrxv70wd57fni+aw+abgouwldnlsttoc8wcqorqmsxamdyfh5rg726nc+a08o4hirf1fox3h4arwpq9zrrqk85bj/qcuopqkecm2kmca1/wbblu8qoiwbkm5j3p1kq45916aui0xzsvugo0vaovaesgvl3jue2qlwpzewhsq2usqv6mzauh11j1b2v0lhm3rvfqipbluijvl9yrkzvo7lqsxq4hdzheszzvlybwsftqwysiqwz+gg8zo9r/tc+0clrr4vwuimopwbcumja/thfarnx5ri+vjzgvewqpb4dlthuqnbkmldc73ji6qx7kslwp2moq9gyt7hwkqgy9iukazukcvqvb9spoyuq95+sinkkvay1tchwu24pvaff6evmyu0mjbeadi/lcec37tljtwhzdcxttfkbah4p0jakinysu56xk41jmi/kkqja05m53m9judyghmpzbfzo8fhxytknpo605tocwtvn6ct1kgnllbm9wpcaktkin48e6vuowzwsb9frw+4fswoxzuz0bfpsmafa4fet2msfq4ia3y8reujejqtscumyxzwaaovincznb3gj5o09/vsre4mmj99c0xy7ueoomh9pxo5zhtjdxfo/n5hquv6pl/uyx5s4h0gpn3rba4rclb5qqok++gvlspwztya7rvwgyssphjug0c8ekysqplu/bfr8izlvt4wqsrlnba5nmk8lx1l+izz3ru1mnrryl1cgwyuuq2vc7f9kjpg76lrq1bnhln+kn8gupwvwsvuzv8asn/3ykv95hqotqr019nrwxw9lwhra8x0vy5fxr5gcn+nnzk32pu8tmw48w9q5hpeb24hvpvqqnpqu7nw3y+4ps6rilclgkxcbo4aeg2ypu1wsbhxvyt2eib5nbnjizuxfwpzm7/tvj90y3nlmyebtnwstuae2rx6dzhwpu0txjvxndfc2f/emol7e8zxfjrjo3exdt+x5t9gvrammbjvmaom50us2tba0kxzpzb5pjczyssd0c43ysdcwox4kjrzleguznc7agb1y0uplosfgpzwbixgiic7uh1ndj9gy0uz5hekrzlc7jnbwkw7ogojdch1gqtv1tjljbvtkc4ogesneozw5oi5q7nuj4sxwymdxgtc3qg296mlzl81hnscdxosptcjdjnimuc9jh8dr/pv/vc3icth6qz+qov0n/qha3szzuejn+vxxzz+h1rz1erdeedberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberabf61eacgf+pvvpakotvos6lnz0gqvkoueab/imils3ndvfvrqvjifmy7+epn3yo8r9e+k0gdel6bkkksshxk4vko84f6qaopshsimkohhmial/mv2kknvwxnyxgemntfpnbb3r5lzl3odrm3s5t7lrl0+d4ec3g9fde04y4t7dzoyh/kge/il989b4kfleavylsvoomjvq1howwelxyqkpjt2mkcftzvlueqnovd8wx0bwtvndq0fqrcm25oacp0/qr53p2xcpdx9i7d6nzr0b2l1zfuobbpejjre9xwb1skp27z5lm2fr4ogi1r/abwg/fmc4ac4jpt71bcw6aelibm3hsw0acfl7nk+j1tjapjgppwzo/yknjm65krjx3+ahadyc2pzaxtz5lhmcjdr32/r2cpbzvxxxjcwizy7hsegjyucr4kq1u4ghgjm7xo5yrzva/pc082uh2rjycdpafiqpxolyl6y3mohawds5w3e3rkh+e3r4lzdpiobh/ukyu/zahdxt77qrtxc47pjt1pimtgidcbklx/pufcfmna5e5w87tvhzxwedcpem5gmpsvcf67eyszp2tkheekh7lfc3yj8alfqdzkkjhk1xppszq56qvg8mgefi6h610mekjvflf2lnus5mjxhmbft3k9yvfdrwl7rasdvno+el4vuxorges4c4m+rvizuihmsyuddyf7f9ahgi2rhznxb0y1vec820drzxymfpoculhtnjjmkl25rhc52us2zr0cxop9kjcsvvc9/aafpwx8uxwo4spnlyct8mbgrg2dl5f2w9igwoyq2oqshpc5p7znkvcrz19pu/p6kpjflpcvgdmug6go0ouuvdwdsgt8siz6nehoyqqyxl3swtgd+atc28rwxayhzoup4poozjypm/hzs6v1hcq2pucnnlopbqxbdjrcsyuynhllknmrml3epro8yqpavlxfstfuzyzyg7pxl58bfqlp/pj4lzflgx2/5we3/agmpxpuxiyr1rdedt5zsuj5enypvskkps/va5boikgw3ra1il4m5unwzajvycxhve5ltjjeacqc8zinoqr0vnwmi8yoyasvcq8dffvwhvjgd3kvjpgpv97ljlr1pidevnaavoq4qex77aihzvyefkkkzlofbussy5grwzgtxulruaqed/qbfycdrtb5d6l82+ixhoz1xyt7fydmr2zpzpjtbyx0brhun8nf551uvgdwolst/ex6ucryxikwyperjbofi9yqrqjdenkehavurcakg7qu6ovqkypv7f4i8dysgeoohvuqd3z+9xhqifqequmsec4hjdq6te29g9syguuembja5b/bb150wvwil/hx/amrni+/hmspgas+qfgtilwjtb4rpq3pum6rgyh2cw+lm+5bryehxwd3nd5sp0ad/et7gsxoqpsrtezbegx0c8wpx1yijlrgfxyc9umw67h3j9tr8argnnkqxdx9noyq4zhcgv4mlhzbjxa59tzon7vdh1bas9ua2xwflksssbqw5oo4xduqekufcgyr5nwup16jq1d2/3gxmym6ehx+9vtkhjzlwc1ilq26adfjgj1plbqjyxhe8q42cyrypdxmxxbj9keq87m8ysk2cxpzoimcptmfvvtofqnnuvsjw3vdyxubnclsizkw04aebush0muapd+xax58fk4j/gyp0ux6jufb7jxsnxpcng7pp/er0qko9xtzf1syydcaex1huxsa9bffzjhg+zx2liwgessbizhmubuvza27hv5q1jq3b3hx/adtb3hz+lultr+cvoza2dboemm3gnygqpjjy0xii3d222tqfzfk4dr9z0w9cr4hqvjvdpc3tmmokj41vnefkkefm28e9qrjbitspdwc30jbvprtbywungdspa77ffkbahvt7gezswov1rgfyc9fojn4k9jgrqsw22itbzusv7hnj+cbrr9fio3kl5l9hibjfnzp9ma38goa6vhokcrrtvdcrtz2o9x9o5re4hwoy4ztcx7w16bqkcg90zvulnvyalyjp7zavqvsd/f6hzf8aqhe0lyhaehducffxag83/qhahrn/an5r576rr02ul7vqiaiilszzyiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaqyimribx9zlqvw4kgusse9ibcpshk8f4b9fymiggk3lcqul0jao08ubcukkhjgxizrxzyql4uawy8rzmvxlsybgeuxxocehei/kkfmhkgyad3b5fhlddw9eltmgqmn1hojseocwdt2xuxhst10d0ayky6mkl5szxxu87fzt722/rfvbum6lgs9mfks0jazpnzmherql1m4wrc3byxddr4j8fynalwyhrcpfxix+f1ceantz9ygq20dr7qshknj7jsb2uufbykmhaf7tkrwe8/pypr9it5dfvx88t/cujirk7ldyyp8aefgvcyt/ac4v6mdz8wvxrjod7kmrdr42brkwq6ato+ecsv9k36nlqkvp2bcjcen3o2ewmzbnate6w5915kadyua38y1h5gpuoasa4vj5dw3mu9c4w9jjbjcbqzvrxtbkvkcoj2spfzrj8uzwxvdnpisdy8tlzn7w16wpuwfimvspwfztrfckttr88csyz8nqpoutxxb+idr9a1c6n6vspdzkezo9drmpd+cdcx9hxov6fzvvgorm/l6gfwhom0aq2oiiininqfhqqaqgrrgdp4g4o7wjoc7vs7sg+2ylb35n2gubues4bgekgnma8hunsrvvvvd2wcxnlcrcfuyo8oownduvdltw+ddtqyqwy+vs/wbsb4nblavhemjtghlkc6zy2f7vibzteyzw+iuuzemivc2jdg3tlk1jyotbbhzs0ozxhzktswg5hdmxxf1rnlm83dk8u8hfrvsacwvckpwuljyzgyletcrsblxljcigyhjibc7q5gdsta+2/wbapolezxg1zco+xzsklm6lokh5v3clrucyipjkuusy6f/ix6wvjdhu06bribmoezljrbxlyhnxty2/ladl3v7qrc33ti8mhmp4uqg+34pwwt2zoy5235g8x1a5bufhngx7e2nufqduuqsf95jdutsfvc8yvhqgw7/n4lw6bg/45pqm/wc+gc7ze5vba8/rkrbmjsgg43295pjskcrmfrxllaldl9zwv0b+cxx1r2giiqxei8scotmvlmg77rgp431esumy70r2xt8yf2rfdc6lsdggrjhxkhflyme1itscwkan2klju7ubhjxxhymjbzpo/h/a46ocgnjfmxabztluf8559qkthsr0kwxmstzf8wph4lnptqffeyxm5tcpcvk0gslyvp3v0kgc5vd1mhoknk8qjcgvxrejzgqbxgc9kajg9wpvb5qslwgklieiohyekyzyppzhkhmdfmxstpic2ytynqdmpmihrssxckpxziwy4qxrwj5oahu5+5yna4kedc6d3raubotzio/+im3t2h1rofhclalyyhrqaangld3br1evdviw9xhooekzpk6nhe2ob5awi2rwbf59onvc3vdh4rxkutlnjms8tlibwv2hfgqpdf2l5/lfck333/atbpthmo/guruefu+zi8o4xewbsre1apnjr48+qkljxftsbthp+jj3t71zw6piw7c4ne5+46rqq7r1x7p0ovsed6rw4dwkfv2pkuqrtvb6sj2/okhbghisqztuup6vnken2u6m2p0gp/cmvidnylefqgmxgtspwbg/+ryrlbx2751i32okkvzblsxr7qpct9zjgwrhlhgo+on2wuaz4vyzd3qy7jvh/wb2f7wl8en5jy9nul/c+n6m4kg6x3nwlk4vadqz3tcfiu4qdypx7sux14ezdhyxh+h8sqocymhz/peotu8f1soe/isy7ny32xwdw5jmhq6bo8bpfygacxsoateli0jt6fy1y3nousyul9trwij1ghhpw6xrpnwcsw9ew+yumniph8xkzhwa3pub/swwo54pu5txywwzkdvszt6i5tr0vwmy7z/1e5usaweexsdmq+azjhpcx1z+n9k5zipnitgmhmhtlp714azu+uvlrvnm3czuqkvna07ax0vf60uexhnrfjr5aubc/pvalelhi5htmoa2zotnlzdb+/p71bdglbdlywsobjcq0arwvu3qazdoixzye6nl25dat1ltjc2vfu2wgynbebgns6jcs1gomav7ntbw3vv2kju3xxza3hmfengtyvc6ob9qtsbdieg9ywt5ee1ryjw8ok9fk4aog41c0x2+koq3pgsmajw53uop/afoskmiy39w233buh47t8lw+wahenhso6nfodmppxckjz/0xgo2knj95raurf1h5mereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereavmrgika5e/zyokiscr6qjwqobescni8kigdwoeriierwoiqd2c8ciiyhbcuhzeteokqt9w9iwytc0koawoa4bg5t0rled6hjgo8/twrb83yrf531l7q+jtr5mvicdcx0wnmyatbt2lewt3jqzjdoqtyrnjesnxh3kiijeki6gdqf7tvvwhuejzxhtkinosjivkd9i+8q/diqwg5v1repge+c9i/waw87bragqx/s+peqvuir+6ztjnhdxwwwefvkimdjgpxh1fjhye1eu8owsedlxpbmdmpgzu7lc/lp63vczrf3fsl/3shx+rmw5/msbvbeotermzwgnbjvurhtzmfm1r2m+ovsvoqmjajaaaaaaboaogrfl3/wb6jqwh3zetpt3w/oj6lz70lwtfr1mzodljejfb4doqiiofeqyr92r87lufewozx4iikfmyl1qsmcdztyoif9usirfjttwbrn5trg5iwgm4wagdpimo020cit1pauyuwyh2bjbuxf9drrighbdhcxuaslneyimrsf7hjowi1mj+ep1jka1lwacsbmwrexir5nzjvvdiq8i7re1ljzyq4lxvfqurzdxowesajacryerv5ckh45wnfj3oiqq+sobqp82guekjy97obd5tc2nhdskl9yesivobhjxekvn/u0oxmdcqooivjtwoijuivl0oiciw1wernxi4pk2ktsrekuqxbaqxg2600gpctvfdeutj/pxujqxbecwa1gdjych9aiugl91jzfslkruhxyv0szu7smzmoxs3oycs2ci/uc5kurdlafyymxw/mmlwoiseyc9reofkfesmrgn6l6erapqqsvutgawthzrtqw/lwfriibifs+/h3o7y3zvswxj28jp7krvocnc1oc+/rt+ebdgt3hk+3ldeuhx7muwvvqsr+jcruhafete4stjlu80cidckg+srysnerogoxd83gdfiv2b59urmzbgy9rgbc21wjo0aegwn9x5oiikwymzox3rcra25xui43/imhf1v1qik/wbn/nxoj9m/6f/vuiciilqtyeiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaqyiika/9ka
https://www.uitvconnect.com/sites/default/files/sign-in-fb_0.png
https://www.uitvconnect.com/sites/default/files/sign-in-tw_0.png
https://www.uitvconnect.com/sites/default/files/sign-in-uitv.png
https://www.uitvconnect.com/sites/default/files/how-to-mobile.jpg
https://www.uitvconnect.com/sites/default/files/styles/news_online_large/public/wash.jpg?itok=qg7vwdeu
https://www.uitvconnect.com/sites/default/files/styles/news_online_medium/public/trump_44.jpg?itok=ecr6rlla
https://www.uitvconnect.com/sites/default/files/styles/news_online_medium/public/airlines.jpg?itok=6fpf5yuu
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/dmitry%20peskov_0.jpg?itok=nlruj4vk
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/missile.jpeg?itok=tsyeq9gw
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/trump_45.jpg?itok=vmddhkz9
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/guterres_4.jpg?itok=ougr67vx
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/bruno%20kahl.jpg?itok=h4_91arz
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/33%20civilians.jpg?itok=iktvyfq5
https://www.uitvconnect.com/sites/default/files/styles/news_online_large/public/mariah%20carey_12.jpg?itok=bbaychjb
https://www.uitvconnect.com/sites/default/files/styles/news_online_medium/public/jennifer%20lopez_15.jpg?itok=fc6dobqu
https://www.uitvconnect.com/sites/default/files/styles/news_online_medium/public/demi-lovato_0.jpg?itok=58gtfkjd
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/salman%20khan_5.jpg?itok=o-tfmtcr
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/scott%20eastwood.jpg?itok=unw1pbrx
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/khloe%20kardashian_5.jpg?itok=e5vdhmlm
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/kate-hudson.jpg?itok=zekcqxyi
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/sunny_4.jpg?itok=6jkkdzba
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/jennifer%20lopez_14.jpg?itok=dxxxmrx_
https://www.uitvconnect.com/sites/default/files/styles/home_page_travel_tourism/public/4_498.jpg?itok=th2nfxwb
https://www.uitvconnect.com/sites/default/files/styles/news_online_medium/public/5_393.jpg?itok=byqvk7-d
https://www.uitvconnect.com/sites/default/files/styles/news_online_medium/public/5_392.jpg?itok=xc3cu2pp
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/logo_794.jpg?itok=cgsbi4-e
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/3_635.jpg?itok=rp3tugjm
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/5_388.jpg?itok=o6iimqwr
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/5_386.jpg?itok=hps0knb0
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/3_632.jpg?itok=brcrw5uy
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/5_382.jpg?itok=hi28look
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/demi%20lovato_4.jpg?itok=q0pnw2ym
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/virat%20kohli_39.jpg?itok=smiyb_5p
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/kate%20hudson.jpg?itok=rkgn0tuh
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/david%20warner_4.jpg?itok=gsevbdqt
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/clooney.jpg?itok=sexhkslp
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/pu_0.jpg?itok=v8bwfaaw
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/tom-cruise.jpg?itok=q1m29xch
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/casemiro_0.jpg?itok=wixmyuvl
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/melb.jpg?itok=kmdigiui
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/neuer.jpg?itok=lli1cmdx
https://www.uitvconnect.com/newuitv/img/paypal-logo.png
https://www.uitvconnect.com/newuitv/img/facebook_1.png
https://www.uitvconnect.com/newuitv/img/pinterest-icon.png
https://www.uitvconnect.com/newuitv/img/linkedin.png
https://www.uitvconnect.com/newuitv/img/twitter_1.png
https://www.uitvconnect.com/newuitv/img/instagram.png
https://www.uitvconnect.com/newuitv/img/you_tube.png
https://www.uitvconnect.com/newuitv/img/uitv_logo_new.png

Zdjęcia bez atrybutu ALT

https://www.facebook.com/tr?id=870968186334403&ev=pageview&noscript=1
https://d5nxst8fruw4z.cloudfront.net/atrk.gif?account=mtx4h1awa400yq
https://www.uitvconnect.com/sites/default/files/uitv%20breaking%20news_0.jpg
https://www.uitvconnect.com/sites/default/files/us%20president_43.jpg
https://www.uitvconnect.com/sites/default/files/peskov.jpg
https://www.uitvconnect.com/sites/default/files/paulo%20dybala_0.jpg
https://www.uitvconnect.com/sites/default/files/donald%20trump_76.jpg
https://www.uitvconnect.com/sites/default/files/tillerson_2.jpg
https://www.uitvconnect.com/sites/default/files/formal-salman.jpg
https://www.uitvconnect.com/sites/default/files/virat%20kohli_38.jpg
https://www.uitvconnect.com/sites/default/files/kardashian_0.jpg
https://www.uitvconnect.com/sites/default/files/james-b-comey.jpg
https://www.uitvconnect.com/sites/default/files/styles/news_main_image/public/us%20stocks_11.jpg?itok=aevmei_h
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/adobe_logo.png?itok=clqwrpfl
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/tokyo%20shares_0.jpg?itok=n1pbpyf8
https://www.uitvconnect.com/sites/default/files/imageblock/b2bimage1.png
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/2_862.jpg?itok=vm63yo9a
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1_989.jpg?itok=bh__nwbk
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/01_67.jpg?itok=10l617my
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/3_625.jpg?itok=zy9xe3oe
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/2_861.jpg?itok=ulx1hbpy
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1_988.jpg?itok=w43b-k6c
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1_935.jpg?itok=hwxy2jq8
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1_934.jpg?itok=8wjvxwdc
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1_933.jpg?itok=ybmqfi2x
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1_904.jpg?itok=vtp2cqql
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/sisa.jpg?itok=lh26gsjm
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/dress1.jpg?itok=vo3zch4i
https://www.uitvconnect.com/sites/default/files/imageblock/b2cimage.jpg
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/wybor-40-mi-15-101-sdl221953195-1-5e37f-compressor.jpg?itok=518-jnqa
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/lightbox-1jy11441-compressor.jpg?itok=rdeaxinw
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/lightbox-d8bb72-compressor.jpg?itok=s1s_i6lg
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/lightbox-ccb642-compressor.jpg?itok=696tv4w0
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/1-7dfdb-compressor.jpg?itok=za_qopkt
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/adidas-eyota-m-navy-sport-sdl879230173-1-6e518-compressor.jpg?itok=sgfe4uqz
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/dolphin-double-zeal-sofa-golden-sdl614758854-1-05b05-compressor.jpg?itok=rfdhvmbg
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/amar-furniture-luxury-beize-maroon-sdl642252154-1-dbe23-compressor.jpg?itok=jngqmagy
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/sound-king-sk8500-4-amplifier-sdl981926304-1-eff76-compressor.jpg?itok=nbk6jynx
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/lightbox-844e08-compressor_0.jpg?itok=ik9ivmk3
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/lightbox-f530ef.jpg?itok=w8dye90_
https://www.uitvconnect.com/sites/default/files/styles/bussiness_product_image/public/lightbox-11bsh26359.jpg?itok=agd95_yq
data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wceaaggbhaqea0qeaoodrandhandqonea0odhaohq4xhhuoebaggc4bfrgsixaqhcsplcylndq0exstms0mmcinkcybcqkjdqwngq4ogscigyitlscojycnmicmjyynmictjycnjy0nji0nmccujiynjycnjiyzjzmmjycnjyyyjiymjv/aabeiacmfrgmbigaceqedeqh/xaacaaeaaqubaqaaaaaaaaaaaaaabgidbauhaqj/xabxeaabawieawqfbwumcgeeaacbaaidbbefeiexbkfreyjhcqcygzghfejsschr8cnicrlhfryznfnuc4kss8lsjdvdrhsdk6kj8rclvwouzeaetmpirf/eabwbaaefaqebaaaaaaaaaaaaaaabagmebqyhcp/eaecraaibawmcagcgawqhcambaaabagmeerihmqvbe1egimfxgzgxfdkhwdhwizm0fujs4qcwu2jy0vexjdvzgrlc4kosomp/2gamaweaahedeqa/ajiiiuunoiiia5limkttnqakqyatsna0ssaazzobfryn7svh88n/aorj96yx/gkn+nl/vcsjsnplchs8kpqrhdjn/dio/nk//vk+9p3yqp55p/1zpvweicx7ps/wr5izf3yqp55p/wbwt70/dio/nk//afzpvweia+z0v8k+sm392kj+et/9wt716mwqnp8atjwovayfesnovubekywq2ibj3wp2lgoh54pmduec6vjf3v8vozmoivjfk+vt37wt2sm+xz8fqmtqmpd8rn9yn/hzonn4lz09awuge4wftzrsntqhql3cmaeyt3b+sujca0aob3y6iplk/o4w0ahzonttnaktq0e/ur5ltl/isy95pnypug2+wt3g/wcvk6bbqj92kj+et/8avk+9xqijc3k3kxttflhsg7ghua9cdz0fvfyl47gwoy8ynr7e5nmt040zl7q+s+zkfuxufzyf/qyfen7svh88n/6sn3rdxium+z0v8k+sm392kj+et/8avk+9p3yqp55p/wbwt71higps9l/cvkjn/dio/nk//vk+9p3yqp55p/1zpvweia+z0v8acvkjn/dio/nk/wd1zpvt92kj+et/apvk+9ysid7ps/wr5inpbvxjj8p7sz8mxsrz3udb172vtsflfdoav96/5x+ntnmlycf1qkjezsw230qrettlciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciial1luuje17dhn2vtttb2lvcfzl9pqvif3l7ibtfkfjqvjf+kyf/w/vc3ugsf2lr7gf6qpfypp3fveerexdhm4reqareqarf4uaeovl+k9qareqareqareqareqarfdjp3ua9zynubhri9rxoawdxo5e1daxiqtfbareqiereaereaexl/feaeoiiaiiiaiiiaiiiaiiiaiiuyuz2hjnrpa2qxje5rmteorxfo35ibsfsb4lsirr6d4a15iegp0zk5rgxx6ndsunpak3wwkrecberabf5cduv4oa9rexxqaciiaclihozxtc9lpk9jl5pwrvcxthchzgldqgrgsjp8dnfrdo9rzendk9rnsp5xszfnkyn7mnslkocbyaefyye0+acwt2j1exrw3iafytynfysb7ac0oh4iutqoy4tfg6nw3y9rmugnnp2vmczcq1rxoc45wsac5xpqabpmrgrdlzjuuor1rsyrknkhfe4jmgsncx2xryjbq+5wujp7orpp4yresiberae4rexk57kereacnxj+mvp9pl/efyszcy/jft/ty/3hwept1g3/ajufcvoereewxq8xqammngcdohidyg/vckgh0fgqy5y2u9anqynvhd5saxafgyjsqi+c6q+da0fen7fjske0apbflgwf7eeoe1h8gtao8fakoo3gy71y07fp9x9fk3lmq08war92nawnfw54af8ay3+elgoadwqqkdg4kkua1hdz3gyqwa7v5je24vykb91u43h5qig1p7zchwdmfjbz1ys3s5118lq8c4fkikesuvjy/eea6xd0go942typootihcjkjkdsxr9l9nvazwj0rw52lzyx6yiiz6mc9hearm8fgqqnl5urogcmkex8xoprkz4rkblgdjcf7kocwpt1dclo9hukrgzmb/kgu+jnzzvadeuy90+bkt/1/dk/p2bga5tt/skpxp8nv4pjcxareqkereaereatlgl/ahr/ajx+ntnqzgl/ahr/ajx+ntnmlyefdc/rp/d6iiijpkheraberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberabv8b/xtd/636ovcr43/imh/wbb9ulc9h/6pgh6q/0uvh9uqrerd4ebberaberahhpt8psaxq54abckaksslfvvzena029e1yguiiy0dbxonxtnjpc2zgl5hb9utje3wxsuommdww0lttjt2xh7g1nec6n4aczrzt2y08fbz948zhbvexybxs44pvksvma4xpvzf8v47qkqgsf9fff2mxlmx7i5jq8etsrrcc3ldvydwnvzsegzhe1wdmizxa5w8agkj22wop6vzzinswynhbpej3uy4naztbmdjaw0juo9kdhljls6sgjrhgmmzecozb6botlt7bc02t8kspuclo+er8i/aysulrl04ss25i9v4dpdnfbjggpne2oj5n43fzglhw8xc/nbzvo/rdi5lornajnl3dksfmju5ifypfxasicaexjqpl1ahzvxz2hak+21/gy0nprq5w1npkqzyhfb2zbg9zr2vahvkc/vcjjd1ztrjjo/4e9tpttrjkc8tjr379maotwcagoip5a1r5nszg+5mbsz8odmte1zrpdbvvo/rdi5lornajnl3dksfmju5ifyphx2p9kwm/8a8a0x8o2i+5ap0o1cramnyvmsqig7zgje5o7xtd3yofqhebqrpso4y0/weqdntqouu8tra7+f/uj2lypnsyckvlnezmlpzncl7t9y28pady5gdliyslicr+wujytybjcqy8unya7bm9rgafu/sebswf2mswt4giw6pegvnrxv0vtf2bo2mhnfcgaeo1wgiltc5ro+cdk139rpy5x5zjf0ejgcttysplfgnv3ggrozrl2hyu7bnk7g135ug6+a38navw2j8r3qmdgoe5jphzg0c51ds3keakgfyrtvgmokhcxxonc+osi9sje93xnbvky8trqgcvufq6sqzn2zizjoy/hmnyfxigdblliv45lng5qvjkmclblyvp2fchtdsezb4wpzjqeaakixhkpyx2w9sxymmwmboxttugj1vpmgpq+omxnkelgiopz4zzl2pkbiymcr0vm2iita/waoeeyxp4ea1mz5s31mzn2fccfhqa38ivec2zclxqagisqude9/kjl3vxxprlu8+sakpuvvgqcxh1m5xl+vti5qcjvm1pfurbkjzswmjdnctr5as4fuuc7tzv3fedaqmjmrxg5g9cxulizxdwihxldb2gmezh3mx7o3zjwh7cq4a1rgbhlosved5howjewvkdiizvmznjcqz5k12w/s73h2qz3vvzlthswvf062lphvqcdxoxg8f4xqksf0twnydbtpswtlujbak+5zu/a9vgyokf2lw07hsoje452hhcthzvgd7ld4ix7scpbtf1nrwgo7k+bkr+v219bfwuq+hypg4jxcttlcgs7ltl37lstblfw186jxdv+ssyzjhcidmt1injny06s9jnil/beartcapqbegakbh9vzg27nohmaeac/yoezyex2loxazm1fbxuecnkpbmio+sskwfbzze5wr6co0vvm/pfkfs4xjzwm0vnmuk9jrw7ltyvekcehrzhzhpb1ybtmewq09dhdtie0744qm0jphkkcopm64zm59nusxz8fqindm+lldh3qaxzg7xy4czh5kzyqx5wwqbbnbohttla24kdxl3m23dsmxxuetfckls5e2fzldn1b2o4xgvgoxhld27i0gk8g1vmwyozhixou98li7korgqdb2k3rcj1m0evregsnlcwnjdncqwkls4i2uc7tzui9gnm6kcuemztn3c1sl8gov3aka8rzlrygnc3h7ng98zyyhr2ktegmucndyniuyv3vi9g2u0s9tysn023mlv3uxfvgd1jbpq7gasidd2bjs7mtywulnnjoma4fh47k1i3b9ttr9rii3mfs5jcxflza7gqoo2upfwpuydb649vixqtq+yklixstbmgv3kxjivvhlznyjxh8j5mjksnmji4gdhmaufekpptdzpfgzwxf7otzpadwzr1lfjbokthcplhhnjecjznwaxrnzxqqxpu2whdppor1xwnwrujaims9q7khrojaw2v3yqmo0ov3rc9s5vdwljhrulgsztjdsrq0bwb5aoi9qrgqjp3vl3byzwx8fbzj2mx5yw2zb+r3uo7rzysyzgf061xh6s6nfpzizjfctrsna+umcxxy54nocguts4eajmqk7hywgmhqnvimc4jlgtc8v7zmzcwy2gm+qkrxudw6s97pcgubnes51m1tmgnwdwj2k5j0dpmgw7s2okymphodaxeaqwjt4ehojd1mpsx97dgt6brxkum/cukildh2x5ga7tiuxfzlzp7tsxj6uw246rmzwrvuba5giekhgka5rnamblbvjdot6w2vzw7lp3x8ppa9hy7k52rwinjw3aspeob9q94ylemjw9rjxx9oazjyxxaxm+suow/s7g+5j9rquwi45ahf2bbxhrmntfse/furjhugkijahshhy45rle4uahw9u3ai2plkt1imh4juu+gxyy0qjlcxkbz2we5/yd5azu7yd1rr25n3zvdi5/dwc97nua2mdo4lztkwnbj620vvj4xwjddx3qaxbsf4njzthxnnxzjkbwswnpspkbjns4qwm+bexmcu8embc11kyojsdzzj3spkl3tdlixsbnr3tdapfxxddaltzkt5krcyuy7x5q5pjvgjljklde3h7dz6u6dz2ubmte5rtnmczmwi7g2zw8j7iqszaw4xggebrmxdmyhkizfzxpsumqqy0wlj53+jpwt6fivyu1p9vcbj/ajuh8gvuzgybsctx2ygd5yxx2s0anyutfxyfuqyshfce0k/gmtich/onmpzx3h2hyyqmuqayinjteyckv8a72rswhca/yb7aadddjhflobhrqr01znry+rldurvkg+tvbi7m6mau9u6c9bakwf7vk+m57y48tyrw6tbwjhvgmb5589u3snzvccvcut5nmanjy6r7o0dmdqln5uxl1uyu+dhvdjhyiqp+3gqmtecvazm65ni3i5aryw0plvqbhuaeqt2lavrnt5xsxgzup2skdi6a9v985z+h0gmlnrgugju+ma5rjzajkdh/wbmvbxgjry6kao9aslme1vxq7/1yx7wtd6o3524jse2esykb07zcx5/u1k1tuawr4eptuwidjw6aukyiwt7wuwbwttlsxnn8detzrcady/8kj8c4kpr7tdi/epjdyuv5an9fzi+/wdyao5hobvvexznylssoe+ar2vmyuuqda535bthiip5jrypbr1dvdw6d4smyhj3nlwdikrfgvk2nzfhzd8oed7luvaggcs+/tt6dawxncyawwq1rsnpvgecqtk0uxl7ecxnheppg55y2ujvyzrolma9hxai9yyiudkp7az7bg8vtbi0tc7umlac0hy6esnr+1bzh6mx4jxcfmiw2o+ttkvpf2qyhgo3fzwv3ha2wlbcpmuz4xsq0ctpyywvddt3ia7dp7o1uv2urnqszzj2fddnttlqvontqx3rc4bpxq0gmrols6kaqy4tjlb/acopy2+xq3aehkirh5jrq1tmumkjawot6twcsfihl1uq4nc44xipdi57nsvrdi9xe9x+rx6lx1k8w5j34a4u2btxneh9nftp4z+ugmt8l/zzmjwntc8ctpewmnbuq8kec6vfvhd8bgxwxbpqtd8tjmdcx+usncw5muyavoza+bxe5qath2vlhhwgsj0twywa5+cxnrogw2h0oql/cvpkzca5snawtumes5r9l8ngjb62zdp8vrofmuqcjr6md58n3xn1oju+wafpmksu6s6cps9qylwtqvefonhr1xp95pkrh2aoljq3gpspmpdqx9oa71srlsbtz5hzdnw9vrchqms07htzqimbk6qkvdq0pbl2scty7kxyo8tsxpdyxc0lbt9izmza1zgp+2d3rxcs1agiylsnpdpxwvdbbmxbraelgw/2077zumtpv+wbj6zrps177ys3/vzwzr8u01y+tyycqvnliyioqtowbmd4au4a3uhkk/cy2ehcdvcm1jm4rfrkij72mes9rc4usmtjbwk387m/u7chb/uwey/ppld9v6vakmyudx+7yee30qqwugfs/kttvo5ct7+n+aaq83drhcwnpvhts6uazqzy254wo3tzv6rinpxcfjwlzn0ktwsbckum8tgfjhggtdm2wiuav8nen5w3uy8jzutqaw47dm3bhmalxk7d40/qmrax8mguuiy1l66ufuxvektokl0tgryri0heyo7lsfmt1ksf3oeiwj5ewcjqvtavwropu7vhome32np3nijbbbbic03bbb1bhlzely4/vxtvdvjcsynvdmktew5uzbnu0gehnm3c1y2kctuvlzoyrqvopkcecpgqiinkroerf5oeyherahj8y/jft/ty/wb4vhlnxj+mvp8aty/3hwept1g3/lr9y+greqtberaf6fwbfmbzuwbue7mtpt1z87cru1nd3wyvtkhh5g2b8dgtkfczjlbtu7qn83okayv6tfs/f729ncm2g4klsa1xcx0zymvn80hbzttupo9mgecqbizncinizswmseh1xste4ohcoyc3t3kj09vlcyx0ijfb9itnz8r7lq+ppzqgegxspykbi+ui3tbufhmy+nxcvf8a/b/lpxnhw14sag9rtvvkiefykd+cbx7jw5elvyym1hixs5ndqr4w5jnncudyk1e3lmvqqpipny6kswafgior9/vpt78heiiutheraberaberaey4c/3r/lf41m1doav96/5x+ntnmlyefdc/rp/d6iiijpkheraberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberabv8b/amuw/wdrfqhukvjf+kyf/w/vc3pr/wdqkyfpd/rs+h1rberf3h5sereaereaelowrhqykbbt1nme3+tytekypvvnvskwktj04zwjljnrr1kmtvn4zt8w4wrauj8mwpmxszc7yy3gmzrg3lzbud3krduncqp2cjksmzgjkw1lhoe1ttbmdhf23wmrq/zkwntgsf2lc69erfgyanf6mweopmmes0l2srnlbrmlxhwagc2lwl63pvvy1je9a4sttha5sfzaqte1uxmtcguovekxet1qppppceurytjollzuza4nxvv1l6asvlmhukomhebjq0udmmzwzdcdwbw5rfxrgj61wknbc1zy+yaha9rcuym5bcde8viikjbu4tnlgduvq9rnslzz8dy43xfu1vzduiy+wc50tqdsrhbxtqsxnuzrayz6f0gymxoznpprcwlmif2m3pk8a+5r9ejtktsjjgeupxkk5qw7l1tie8kxqtnkqc4pe0qywcg2fh0saphmtw/jzexmdg51m5rmlrpoycjc0tsdn5efrafesrallgvwnhf14z0ye/js8g4pranhjgfc+mkueu7hpdhe6lhdgdel7b9upukaunlvg1to5tblnno57jmwfi0b2szwannnd7vreso1pnt45fj1c4iklljgz4+ikltj8hdypk+vfyydtrnn9bpl3p0dlvh/evttwz08tidfuf5kmjzdim0yacpdwbo0clrksu2ptny5efinv9wullvulhe4lxccokxwz6iwywukebtvgoa4bub3hye9dudprri8vq56fdkn5durvqaosrtjzynbnbleuy52f3h27rmub5gemkrqil79hljffzykxvloy52eswsz/wdktpfi7+0t4qpoylkpl4xnptnkn1afojowpyxjd7ftroq4jpintlhmddk3arltvoub0cnnivafwi1fkk1hmjtlkmtuxhm+z6qctay3phf/ajtc/p7g/l8fradgqycwwekdofo8ytxoydc9xn7lnlc6ggqy2nvhirk3plks5nf3tzjpubyjmxtieuq2goawkoi+vftscwphrzi4kjwurbmbqrsfiqyd5pr3i1/bazz/wz5dz9hzwmqq7niqfnlgpb8rzuq7k5ow7wpgx6thkmgnmpy2wggo7qsoe2qyjozk7k4pagg00968pmbqyaealjbayzxijhpbizrnzldlchgdqaae9wcngvcihrpvo3o4iukyxh8lc9xcon1pyqujzb8nfu+gydtpnn9bpl3h0dl4mcqrsmhdypk5v3y2tttzs/rz8u5+jsrwrc1l4npy75+io4rc6u2n4erwmeqrsghyqfjzfv5zo21mz+tny7n6oyuyvxxw0kfzqvhfgl5gzsc8x3ooyq4aak2n1ilqocxk6fnpprl5+jh9ruitsjldlhwmqp4prpyjqeawkvlq7m+rzhcvursgmicggd0cuz6qjeoiqmohgp5wqcknldg6nsgkowmtgyl5b0ceswzgrdk6nvswglxur1l+4kmps5wpgz0nefs6k+qlshyftv5zo20mz+tny7j6oy9xhigpqyiaavkaipywxmnsgkowmtgyl5b0ces15rovvttzjvn4io+rtaxlbgpgjcm4yrxaabpbjgyzd2sjhgyr5bwzbwbnuzbpmswtx+onpoaovkhyqcnrhmbijtkjytzolydoddfgokvrstyl7r0uoxelpcu2pgbrd+nsrp2cnksm7gjkz5sxz3nb0zhwj9t1aqela6wacdzqdslpn7emioqzm2de7itooq1si+yus5wk+pxlioutx+husq42xcdhjfjbcx4lxmny5r3ntqmxebeyy0jryadf6ifsowprefghr3nwu81hkysmxaakl7adsy/i6mtldnmlsqdqha7thpkmiytputcpl7msjs8oidmxtym7bauj3135rfrdowcten+av1vvnu0/vtzj2m0xnieqrrgyobttbe/tgibsjsxzsluu830lverwecq1dhmfpkwscs400zs+ln9jtic32fycjv2ano0y2h/bq/ielq9bzm/goiqutabusseyob5pc0sjlurdcku969q+iqmanhpzgqcgn7mruy2qsnizk3m4vioh1sfr0qramsyxasvq8njuxoz9xsadikpp4z6ejkbiqc8ygrshkgamnouh4a0aost4nj1vrf3yerha83fbm0vilrwzgagg6dy8husjert6bzlc8hg9rr04l93zg5dxpidhub74jg1lcjmuzjanmqjlca8w9ynw6wshxqeie6snerc9gje2zr3mtmudyoguh58ysneitaai4pbmwv/xlntct1x8tppoikmgplrgdiz584ka9rzfykhkghwitlbbxkruultvqfljuzm/amldbo7k7qa1uxne3dhnyqjvb00847y+a13tzrdltnpxm3escqameope+ogefjwrsu4c0ns5xbiljf13x5wwfu8d4li1rtlbgguas+knzxywcdlec+gntbzdytgia7sk0k1wpj1g4i21j78mzien1ntphuvcygejjwrsuwewnac4g6un/xdflzbznpdxmdlekd/+z0umfz0eg/br1eo0pnjnccx6jcrbkpc8lukznue95bfi90jyagjmxxjty3kprfolhyrsk23lherkitheretnsoreqbyfgp4xu/08v94vixc7mg7egh3rkxj+mvp9pl/efy0hrn/sh1qvhqfh+th3l6hfg+jhdcafkjtv5wb/adlax30eyddtvmrkuh8cl3sjlmizbuhtmu8jkfh5bariqqfia3/h5p1vvyou8fdxypkaxu7x1envnz/if6nzos7bqdslttrvf2ytxrvg12l4bhxwctnw7/hkp/iyf70lch95hq9w2qumvjnb/wd4wwz+ao/6s3+zahjhgsgpqkomipi2rjrkczjxwjcbexpiul9qffvsk8hdavyb+ufuvknnqb0rjypllpqd5k4pxlvm05l+8/ne0j3b/avduunnnltudji1xe4ssnv33dyg3ile/wdxjhm3yr1unazf5ldeguicwjpkdlnhalha0ioytkdn75ub5hzjhswfu8ay1ex8kmdxszg3m+rzjaa3qe+okbo6fmpb/d/kad1t6m7ifh1dttwvfs77lgr8cr//abhhn80d/wbwb/mn/wayyz/nhf8avm/zlp4qx59zsrtynyx73pbay+xr5gl/jb7tqrmavksyor5gpw6hf0pypzqzynh+s+v8sjf/abhhn80d/wbwb/mn/wayyz/nhf8avm/zkjy36vkqcpqiw09owxsuy0uehjao5ozbtgr0ksvlsyj44y87c6j0ecxencpuelz7fapw7lpws+40puotro+o5z041z19vdk3p/xhhn80d/1zv8y43xjggo6yefrbrg54gbn8mrol8+y9i+ke1c5x6yslznpqpo9umctyorsfc73pluhhw8xxbn6pdwru8votnyutt3nd7fp8tkq7dghoyojs07qinc6z8bxyntjg2crflyhlcd2llncgffkq2miiu3ohyf0bdxa+63tx0mjqolgipzljznp0q6luoufgjjxf3nh4fkvzii70y4yntsoagppazf5lxlib0bqjrtrdncxxzgmznzgd65jpndt9inehyaikdxwkqlwx9qco873fwvn9jfai4jfid6lfaa+uvwqsceem21nu/ht+jmeav96/5x+ntnqzgl/ev+v/juzwzlkz+uf10/h9eere0yqiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaq+n/4ph/9b9ukhv8b/wauw/8arfqhbno//viw/sh+il8pqiciilvdzyiiiaiiiaiiiaiiiaiiiaittr8ovmszlbtumbdsdnecywc1jsf4cw+wfsxllnnd5ryaqb+owhv6l1cc8/cxafhvqvhhffbk9hax4c9+q1wffgts4gclkjdq3ukx8iut02a0rhtmjhzg8nscabp1lvn09xhlcnch9mbfwgmycgeqoz6k/wc5h5mts6cv/wak/dg47fwvwovajk0njcw16wwlng9qw2dsytptkv3hahguimu/ddbjk7rkipfcegczdqfstwoolq9doqjqc2jjlhykewi3b3hhbkvf0rmbt4hixvvkkjjw5mdk1oe9xp8athc1u4ub6mni+tdmw5c7nody9ydfal1cedmt/zv+jqh0wrubcx6vzvzv4hifssnwgeo1ijuobnenhvxt6tgymjlvybxtewnfg8bwzftad2rno8dbc9ur57nrsgwmxy+tt7eahqdstxqlf2lij0gev4r29hzehgwsnrxta0uyl2yot+dbmftm+jot51yzxytd8f0kbeqplqfz8phwnohrlwpkb97/aohzco4akaay6gseby4faorwaee2kgcoeyaltut12kanc43e72c1srcvvutpigfvs/pwtvjc3kkdogzzv0gn076f955ia/skwm0018djlyyrmvs2pgwu9nd7ga/whuswi+ga5lyenydbtghtbnep9iqc7zj5k4rmenhmzxy1yr1swf7sphqqyq4gr2ymyq6s1ltkr2vmqtiasywqksv/kqxns5e0lgtvbysiypypviy4gmwq05izcxwnnt1ihntmitsqvmditezxg3man4q1nspygl0bmh+rs4ex13ckukvpuplfbjotzhw/ii3ssdyzczytm7xbclgiwezxa35pjme3nglwbhunkmqtdzhu2qlgyvc16kp7c0lp0ltli8el1spuyf7bfwymm9m3slny6qhjkairjjliqcbyx1nviths8pvuszlzsucwdmh6d4fmjmklomewsqptn91n+41il1wssclw3b+ohejxgereaereaereaereaereaereaereaereatheretnsoreqbyfgp4xu/08v94vjq+s39ifwsngp4xu/wbpl/efyjdyg9ccpueouf5mfcvofstazqa8vsws4kq70dwl7wp+pyudbcniohai9ysyge1iljzw7rjmx8xuule6pgoptutfznelscbnqqk/4ih+8cs1mhswulzinninr2nj4tpmlz8myrljuqv7nwjie2r8pbdqab2b5nrc9cetawnz1+6uast5vns04e+fyd4+wekjnhlvfd6kdqz9ckv5x4rqcz1o+rygn1yxo/tfsw9v+4/cetwczdu0v8ufqizejx4/cyi/qf8a3rlc49ep3orf6l/efooc67lqugvsx3945vcy4hmoaox3zb/uczh+t8pylvb/amtl/wcy/wd3fho8qmuhwd86x+9cpskzxua4lntrqjxk/vxlfir8u6h/kj7kq9v/ra3/abs+rop8tuvwvz6zp+tyndwohljlyboie17t4g7ljx116mopwv/1rxlcqvfr+9nqljfstkcxw4x+ipozd8zbnffk092rgepdty+wowhxlakmlqidy5hcz9magj3ln/agnenftud6v5sp9envae0g+0qbfk/fblkaq08+fj5dfw87c8cf/deyv2coivosomnyipc2x/i8d/o7/wdb8v0r5z4qm0usjusnuvuzz7fnf1yfishidhowp5hg94jjh+mrv7nsilbuqeh2c/up9qu3ok3k0kvwsiv6qcd+u1tmtdeon/jm6f1+84e36lel6xxnzqtqt9q8whvqoc3jnqdhartbefgpzfn938yzcbf71/yv8amahnax+9f8r/gpmojcnfdc/rp/d6iiijpkheraberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberabv8b/wauw/8arfqhukvjf+kyf/w/vc3pr/8aqkyfpd/rs+h1rberf3h5sereaereaerbxb+h5qoniaxjdx1el2xjwvztzzjbzk9isntnulpgss1krldyetnjs4gghypnbyvwgukoa8tqbmbli6mlgjgbzp5lvy3ixyljrbdoiybmkdiq6xoxj5khxttwlbputu10qwt4kuxhyfgm1qxz4sjy3eapha+ybzviwnc38m6kejwozo9a5z0lbaeaykovkhahwtst1/ltacadfqh/k62e3efwzijjdlfemgnc09+mn1jhbwthkpqfgo3yljtouc5uu+2vjzxktrhjigodjwrrpuxoenqhrpdlfbkfxjmb05hawbe/o15sxnd7fnlw+t7ldcxp6qovtthszqyptd8jjferbzobv7vtmfoqqeyyvqz8jweqvemrj2vi1vfzczjuvh+jgweb9o5c14fsgx54wsefs/e5vkld4zsjwxymee6+codmbtb3stp4ldsyshacsxqj1i2/urcd3saa9zhpfm+slvpxx6lc+mekaij5hzh2lxmicxzxod4ti23uekcq09k+pcq1qdrs1y/bdy1jph0jxjdtwvy4nkjvnjxubmqt8kyfxsmdztanmdmlqp2gy5eyab3huwo4wx19o8thy2kddxn7vt7tkuruk0rrfziwwtucxxcb367ek3cnuf4cyrd7+zm2sd3jvpzev2swkzy9xl16sw6iiiiaiiiaiisvlwgoln5by3f08ucn4izxdjsjhyxrz583zm2swc2w5nxuokg+0ncm5ptpnbteqwnljfmyvjnenc0kvvfuv67radvs0yqmfvoyuzsnuer9sjkvcquzv7luusdsw8qqyy5an7e621nr7gc1wgpzjkxssuchnia9k5cw2dygncrfuecvzylftb2ekm8jfzoco0yohbz8wtfgdc0vdj5tkbvhmvldvhorml46tuslcezpzbklwf1pifsaquwls1e7dq1pyfhn+hku1tvh3z/k6cvew91ozti8xfrdzclet31apmtnik8l35oyhrx1ccrbn+aos15arvkold/iz9zlvltt5lbyfvtbwh2k24lilvbc1tplsusqjxgwe3y7t6dhmz5kc1bqctkewuec7mggz7uapfrnmqlzvae1koxzng5hku9onoxuzfzgsywa4xvmdmc7+qsbn9gwpu4jlibvnkdbqavog6lx7fjugqmjcpocnopu4y8fklyvwoobf27ohni0/kosdvvl3wut4yuugmncupvlbu6w2jnxry9niquroq0qyqccrmaijb18l8l03h/i2crpy+cuoya1kjs0w6h+x9wxmfxb7bo0x0ub5/ufwulenvykxlo9qw0sw3z2jhjndebpoy6n5lfnmfi4va9jw9srso1igfzu7ssslmx9vx9vwvu081segjkkydjtobe6y9+ctuq0cs32kq8s8m1iy2q1clxkbziynys8wn9ygvv0pqnos/mtzt43nkvanbp+zj9x5kbrzkue1dg53usrw753mcbbqtyweryknwzmosj95ypure4aerexqb6iiabe8hugaiigaiigaiigaiigcciilyc9lciiaot4x/gkn+nl/vcsjzumfxip/p5f7wrcup6jb/yo+5fqnpdfezmjizn5hmgvkh9vzeqjuty8exbuoosfiumq/dvym9sv7p0xoc0an9pwmaou6l6kktudw3klndp8z9jx0wdgbpve3j5k+9cobjtsnqux+0sqx41unerl/tkkf7ft8mzp+qn7xqh83/ynuqipzgc6srsyg7ned3dvz3ibhxuoa1lxfhstcf7vpech0wjkkljdznop0neupvvcq171zjpisi3ok+jmbwqq1awqs4s4t8/b+b1thpx+su36b/xcvojnh5jufoj9ylmiqh2a7r4a0adnwavsb7v46d5fji8joxoi9ykv7hw9ghxgqt9gk0rt19ccowrg/nk6pwmf9eh15yf3rluw7x+ixhm507x02fz1xnah6r95rtvoxgo44eu/rwrxrzqqolqbfd7mzjh8yn/pxfwsferxz85apnnyw1j0qmkb7jl5izmmrtdlhipmu1hvvme4ldxjmdghbwica4htyjf4rjirzn6r959ys2114saayje630l7fkm4suzlz5xk/wavzox5vh4hqdjpeu0leqn2wjx9m7+7t4qndofph3lefs173xiausfppfoy7s4vapnsxwsd/p4hiiizzrizcbf71/yv8amahnax+9f8r/gpmms5ppuuf10/h9eere0yqiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaiigaik2z2a2mjaehc0fbkk3wi3guivgvb1bbhuwpxxqbqiikaiiiaiiiak5fcxxowg7jf3dqvyym1zs0bu+wdvktosggc19grdc+jksuqord8dc5eewtc22j7u5nitfykslic3kq2/fprehh4k/lelagkj53p8aapj0m/d2fexgirrota47w6j7ryvpvzrcxhgnkiijooreqareqareqareqareqareqareqareqareqareqareqarf6gdxv8b/amuw/wdrfqhxpkrra6c/5zfiosp45balw8dm22vzrsvvdbhjxsbrhekltspy9n1rakxi9xdhm4reqareqbxda57g1jc9x2y3c+ackelvietgrywzgi2a2fztkigwntvrwxrnkq4y57wipvgf2uudya3qup4tirygsumz5x9nffomz/pkfm3dxpqkglm3enwpiuxvc3htt+zcsb4ipmsbtmm7z3xm+uzwsv1jlfccjq/dqz84ej5gvayzukxfgbru12hw8xvg9lvz7nbkxsdiwwag31bhzio1lwcye++uyrtldxnylpmrns/gdvxhkhldyazyvaxato7ppruyys4l5l2r68mqlxyjkkrqwps43brpkzgdg9g+c/md5lyzcyryucklosjjpxdbajovucqomsoiglpy+x7ohjrowxe7z6kaks0lfdjh8gjmgpcc01lwbpygbpb2cpzypaizw/mvqvov4lsmpjyt2x5+si9s11ptsuuknbupjf2vdhb5a0fvlbfks/e6xdkmr8n7puijajdxwz7aqvy+jyqwipgildnyrvshnagyg2cm2t917w/grfkcty6coeold5gb7qwt10dw8lhlb13ldlxvutw9b+etmtttwh6uy437ngomi517npazcczsz79wna6gtdkhssepmgzwbi62zzb6fx5rqvnwts/j8/yupke0sekaul7x06es1tbwn8ogcw4fhstnn22f63w4tqfzcet2323xsmu7crugtmyp8+qnuc3wwoovovrplcoa0wa0pcnlbx5rdmhcwlrmlrmnkqqd+nira1woy3e5zqlodata/a2vhj9tc4ozvselxol2nwlsut8o442ridwchn7sjcnn23hgujkaejqzwnlad3swoe07wb3vy3vc+t4um5jyanfo97ujxvnvmwdsrutcclg3b5hvldoxciiactskahna3o9resrdsexitji1q+nkr8zgcvddbpg7wi5flfzeblselzzfmfy0sus0rnqijha6mi3rx5farkrjnfxlju43pn4behq2ijxsrzvrqc3ioyqobvbqras5gqjbsllcyplszfwwblzir5aqs1lktbj5vqwrilvswpcjwjhivshxy1uoanpkbiy5ctoasghbdachntm0ehs2hni8w06d22suainjji0pvjkmewznd3c8ckfympewqi5ezu3mppoo9lbxdiyom5koiga1nqzvyc7zaoxtv/jte3f/yvt2xrbpcnbnntpyoe5qjo0/f9ep8f2rnc1lq/hunmuzd2yvecznqd+wqhp5hh0apjo0c162+b4qaqozedyes92ps0cvbstpjfcwiqwrsocsnlyymh8i0d1negis+ntpy8pjbjnk2r1oos998b8ktveuegdqgwgyjfqspfq8ltvajux7roccyr3swx1i6gjayn+f4tqssd46op8arcwhzt0ltsoq17chg5ytelvk3l099+69hhsk9hdc0onqhozc/zxwdf7xnsmm4vpi2zbssityvclvpm7dbagemagtfg0wav1y9s5qte7oqowfckvvgvqylhqrwjlfe2nv0waae1zs9wjwqpe3k2yxx3e22f2dfdy9y1hrwir4gfjgmqxaxvod72eimguuclddp71xsd4lnkndqxehnqx2xa6fhubjxnmzlljmdjks95d1zkz+8+iy5fkbp0tc1+t1etbmnrzyzg6hyv7vdylj984oliumx+jejsjhfkxuyhzje5onx9g/rzunchufzzscds3zc4ozfukdcnv99rpzswtixrljs28lh4njsprw3vulbokqdv7bmzav0ts3ovgcpstykdrzhew15lxqaf0j42a2lighz75rrpfofzrqu44bwz1vultmprsb9qyiq4nv4blc2omkznzkyden7x/seb95ayolphrzvlkscrr3onxh7xotsxwtyeal+kcivmktm8lmte2+dszbidnwud84kj1nc9tfgzxxdsx88og3wyq0klnrcnvnzz9uan3rrxlqdnny8sfr9veae6ii0eywreqare/f/wbqaciiajwiivjz2uiiia5pjh8yqf6ex+8kwlm4x/gkn+nl/vcsjsnqnv8ayo+5fqlfapdevfusxzpkyyoayzoxma7p2jqbq06wc7lycyvsbwzhh5pzdjk+oypbdkwoielaanglnd3fbj0mx/l6x1vvhy2/m/b/alfgttj0rr8gy5vflp6nknbkkvbjav8aovavfhsjkhng+7+rzfzf1qxvdll/dtjfrtmaeh8zw8h+jonqqskeeaoy+yvc1ktomjsw6wjbytyj35hc9xmjbdu1ulc4thnlhyx2zfrzcaxab2a5lvnlvnhrqogz6sggvjt/srbppjaj39pckxt0tmyqdpa6el5w4yqmvmecdgt1fzcjmi4pqjby5zhstphulircvjvg3fxc4x8ll4s+beltohqckepghmn7ckr1nzac3dngcdbc2bf85ddwxcqeqzry8kcjillsnkdgye6d11gjgnxqdldcg4djhx1tg+ns8thy2jma2rrmgkc9mcewj1by3cj+zoli+u3juxv1qfafaghgcioxmxtjlnnrk22zhok8kgpal8vpvfkiw1pz3y4tcrqxzhoslfhwwjxsoi+fmt4yykhjztxvjy5/ysaxrwbhlnbofr6w8yfs8drsiwx4prg7kp7wtmz3hjnnvqo+4e5rehsw1csvv60m2kk8c0er6adkngmqlsuvlgyepnvzem4lwclrjzw1vz8naypmwb0bc833zo0soy8fbr+thaywvjjbkxkj2mmggewonngeiaptxq/rpsu9vwv7n0uloy3tiojy45gxtmujwgjswicr4nwuctgctikpyzio/lfzwpjy6nlqxgblyrywbicvuduy4xu3unn1j0a9dz1nqjf6dslpl8zmklqxfeggxmnw+np2vrp5ow2bsmnji6oaeza/5gynlzo+1z2kuof4nfc2wgfdusg6yna7na2zxdrtylnqafvdn+zplzjyxl/ilxxiumdnktlnvthhtjj6t+fuqhgbdyqmvpozo+0ik7xozm5t7qpi7wio7rzv/wbioeq0ta+gcls4xhg4mzpfqw6m5jpxw54vxcgfhkwsnpg0srbigwntorspudnn7rj40wz1zjbkcoy9rhfmf9fgys53nyh4j6pp0dt3qxkgletj1joo3ghhanfvzply2ltli5oi7e7c6ocojow8mytwuymkxn0l5a1x59pknxqlnmla9fzjjzhttdvmomnspwcaig5lwlxbjvzswn2ekopboec5z2zbsutu7mqqelxbwqowt18g8p2mi6iirmytlgl/ahr/ajx+ntnqzgl/ahr/ajx+ntnmlyefdc/rp/d6iiijpkheraberaberaberaberaberaberaberagrsupkdyaaaud0c2frhtbdx1ippg9/hwv+hgyxjq7u/csintyfdqfetslbr0est2v5tbexhjyxnnnnt9xsktqwyuubduh6rwz4hf1dbwn7e9q1lks3huojwxc0ik/uut4/wyqppbj3qwqbi4vdju0+aiimiheraberaberaauabjngnst9zkhgp8ylri2e2ddc/mflosrj7fhxmjjjcbmahyu1vcnut9wuucvcjipynrex2sfoy1rwzwnc+5sq1m3pibabiay/7z2u+pwk7f3m5lysvodieflqe/mvxz2uryprxcihj9yuuxe0srbbir+zy9vvtnaelwvblx5y3aadd5ljgqql36aed+azkcrlxa5rd27efjmqwski3qsaso8hfewn4xxatw6ojlg3s7cdm0nnvp7vufiv6lps0sv06imsoiikekciiam2kpazqp4pugcwtv8auqjogaygxkf3wjp4rejle8hc7xtlxafjwvdntrtjebp+0apvl2uejndg7mfpukkxbktwum2ie52rmmj3gue4d3lzdjvnlvl1anm+tj4by09kmpmte0j11ayh3ut3ctyjtpjhzvljmexmki9vxord4kzcgebxoljnubkug3btborumhbx+it84be0k80obe/lck4yob5ps6ccyaid+uakppnrnk4eii2i6g81zw/q2h7crtpov6h7loxnijbfincfm16wh7cesjz55perfapciiaciiaciiaciiaciiaciiaciiaciiaciiacykom7rwbew3j8pd3rhv6mmlha+w+sfdgpaubhxsbwowhgbss2wvmjupafqigsqg2c49leadb81vxnjbebjbszhciug4udwszcmqqst2jwljdw7wtyt7fotp09aawbulqgx3mkqkehtibym2z++g5la41w/jvw4fg1wyghzpjcl5rlhju4xtdoxtaxloyfo30a9ykc2jxqcbsj8pl7rndykdy9fesjsju1x5m7qckdsl4dtjbjqmo4epirfzdm/lyukoh03y8lyrvr3svh5mvgdmuxnoyw6woyl7hggeg4oxvs0ftnxoru8ma7c2cdohyob1xozel9lvgj6mjdb+ywproakymataya+4ybeew7rrykan/wxfjvqdftzcjr3m4kmknmvyinf2v8ly381tapgyqkboqmpzwo3j6e8l2hshfnlf/pwf/k6qa0c9ha+pusuptfcwv6fqkkfrsb/a5jw8e1mt29mc/lgjri3cp5shisfgmixafss7jjtnhwjfl8cbsdf2veeji6hpbktjzdeo4ajjrpyifgmjyzrrzkmljc7tsmrs1xu0g81kwbnu8tba7x+attjwadugdnikdzh5xkynue/g7ktxuclzgmecrmqcx13xswyob0drzud0t3zj2fqlruvv0uxg+dvkzxeofu9bchgy/kczmyrwdbqc3nsua0mftyuljp80sbdnfylrjadyhm+c6zx8iwygfkkto8ntmicwg/pn2kx8i4m+tpztrjhnkrlpdb5i3nwknxgntat9yakn3yzr1ljxx5tpktypddw0rzcwufbldy2ancyqd1d053uw4f4mdraxzu73aoidsxsndwgbft/amffo15oyytpl5xode5vosphehgsinali4yztjm06xadyhck2nwprnow8essta1nprw2mlhrs/2us9ljrkefj3u0jynafrmwe0x69bqqmn4timldh6oosmjrweongvhczvkio3mzuio4dy42wocfrt08vz7baucnz3vdzhwjyxbh2dyv0cdrty1kblh5i7nqe6fennnyxv+/oddxtbiahnzymgw+y5bb1+odyxkojmdfllla7m11y1u5brstzxq+ca6awfxly4mdrqvebuc3x6q7jnc1nvou45jgl5moga3vzeysukzovnmnt8x17axvkcqu4ru+m7hhrlcye0genrpuxy/r772bfvvjxml4dlspaky2ctkc0g5hfcjksajgjydsxtdvk/ilwlkm4bpy5mltlsq4mt0+gdz4eqwnty2tolbc4ndiq4n/na7mt8sddkbktbrsdq4nngmvlchz65ybtllheuytqslyexhwpx3fxtxkixkdoxmn9rysri5pchtngexkxbspmui7psfr8ffsrrdtizhmzn22og5x3gwprawxikpelgbkpzab8vghpjj1cd3o1j8yvdp27j94yq96p7qtz++xs1iuhq9jytyaxj2av8fxl8ntx96t5kcr4ngon41qnvyaqge3i7brlxllegmo0pvefqti7bzy35x8atls8pzsndga0ool+nvzvd9e57y7lzguhp0ufzqpdhgggacwgwvarxcxijdtrrtwqxbh4+e4go8ssd3ehgosw8v4w9xsizc73d3besl6pcf/srqvnpos7k0poomhk6iikzfpc9tjyuiox3rglv1rtrhic3m13j0brx8i1q7ixby4sphvmetead42+kbyv2jc6npkjlulhrhvf5rgmlyabck2ahxoq2ys08lu9g9ts0fxxyjmppngzphsdlagnlq59w3uubtrdqkfhw5bhqwmr5bbnkoz50tvytp3uut18conyvjpz49pz3ecwfs9hmjbgw6onibl8vtlzxj+fagt7sjjz4z3mvyrdzeuvdkp8dp4xztowafuygf1jvqsycnbg0my0na3qngwux23tttxzlh9loo260st91z/mqz0fsma2wn2vsoffsymsuxqeo2wxrxbuixd9sbx0z+2zw/knb0b7fuqiiiztndg3pgdaua5gdy8voky9xwqnjibiphf8ts5t2ud/jnpnra1um5+aesz0nroxp8tny9u/f8cm/oawjgvfo07nasw+wlyloiywz+a4lykn6ebvutci3subojchzrsda2gwaq7zfjbywvwere0kciiaciiacpc0g4iudor9iqragooohaeeshkitm4pex3ef+gb23wd8hjud2llgwbyjbosle5yk3lsjjshfysr5zusrhwylocdu0gee5xetsqjjuckivc804jcbllzkb8grscu8fr9lnpaa0jslsatyt5m3vt5eekefzui08sp1bchug46us90tzi7uda4ah5itfkhc/thjiofzxtinmji5th2mv2a36ipm6hdovswtlg7i0uggeqmwhqfwv7sqesm7+wacaw38fi5lnwdwtborj7cmu1pkfgvwjvmuzpzi2wtasyzg0opjm5rtxwuxpcialusanr+h2cpfp3cix7bxijnbv6lgmx4emn9thqrs3eebjmzpzao0yghwc8hpapk/pzfpq7pnzyc9lp1ym1ozloilza9yciiaot4x/gkn+nl/vcsjspeugqp8072092vmkc12eixaxmxtmwn+9ss/m3/kh/zktj6pqvrzu4p1i8l+8v1j/wchwl/wdrfzdop/afcr+qq/rpirhnryhkadq2pja8i2p19xzgue/vurp5t/5if8yfvurp5t/wcsh/mrulrrpwum/hjj3vnaxeq8pxef4mng69xr/wcrfpwj9wxjhyjh6qqhm1zjoyzy7nmuni88l/6y9pzyieiqoz5gxh5b78uvszooyhe8rgv9rgob+9ss/m3/ajif8yfvurp5t/5if8yfdblbvkjwdm5sca8unt8pca7d85/dhxo2w0czmsmsulaxtnc2lw0oc25yxjll2ngxxv8auol//np4/wdti5/+9ss/m3/kh/zj+9ss/m3/ajif8yfk7txtw88kfdp1tt1t3mhqpunxfyz32l/18ye8ry22jx5kz79mio2skakmdgqxw520pswfxnwlfiuvyymxkicrro1jtizroaecdpogix6lmf71kz+bf+sh/mn71kz+bf8akh/zjv2lpkkspvppbkrshtdodg6jgcy6g/vakl7g/wayd+iml7ktxgloh9k0x9o31xzzrzh4g11d4f/17i//apwf/wb8xc//ahqvn82/8kp+zp3qvn82/wdjd/msruvfrwohnkfwtbarktj3ec1iqpbbhf72+fly2hfnyycxqjglmgsbmb1lxnihwxruicfpsbigmp65jji2kwnnhkdsyrl7tit9e+hxkf3qvn82/wdjd/mt96lz/nv/acq/5kkbhlumsp9h9ehbtvkvo4jgdnyusp5wmpkz+zkef8e+r45sqduyfk2r3asfm3njjputhxnjlaphop3gljyo2ywfzkdewk252zx9ig371kz+bf8akh/zj+9ss/m3/kh/zivxiomk75cdc1qvvfq3ex/d8nrkwc5y+duemfe7nita2ocjspx+bkdmtjidhbigabh+uk+r2puhjon6ionuwvfcysdcxjg1ebymnyluyts0w0lnd2le/epwfzb/amkp+zp3qvn82/8ajd/ms1rnxfj89vkn6dbwlppv41nplc2ipfgsex5e3uavfuv3qvn82/8ajd/mt96lz/nv/jd/ajlvnv7fa/7wp/7l9tccbf71/war/gpmo1wlhu0hb9rhkz9nl7zhxtmvsdnwpkmpk4brfsns8nkdtw263xcciiqzaiigaiigaiigailfr8qjgyxyoygbdm7wa5p0yutxhkrtjzzll1c2rvspjcinrixftqpfbxjfh7ataz0gth13tsehoryhyv+ptqjw7kzuo9kdarcwj9idqcluy8elw6jz3uw4d4nbvhk5oy61wqrbyakjqwnsczyphcrkb9f6w29ux+4rxu2se4vtdyg2vy3t9iprag/zwt0oa3duphyhnxojczci3d76rtp4gc1rancg1mujas0xttnblcpvqseauvdo2wmzsb867at2lee33rvxhhj5hfegkraqllnhscojmiay91u+l9qvinedgtmzd44itent9s67ssepwrfxxdqsm55kg3ksl8rr2k18xjppejse05osb8itviwfa3fg0c2panj5dfq4sgs5ng3znh1vzwzhvbxvnngnrazimad0yiitjilbkoyduu+b6lxlfnbwlpzzjjnzqretbwreqavtgxia5mw96pwrsal2m4y9w9jd9yfcoqsj5jzpcbod8qn+vvgyccm+phtywhsw6hcsadqw5y0wzothvb3pndkw9xt80htoenhzw4mqy3plwysun2hwwvdn4xejsku/jp5ud6d4/gga9qb8qtsfrxfmzgsw+i0fbt+cmgaq3oryveepjzyxjkmtmict8euvq5hd866wpvrk11zbuoubo06/hkp1pbcjf4rz4pec4gwwh3c0topucszeru6ahnbyzgis0+iimebd2an5j5zdx710wqkuvn2mmokdcoie4ctba/cpwjqp93pjrt8jyxweiilmlireqareqabv1lq8bpcpavarkm1wjg2fjidr2e8ko0zhxkeqpzlys699crr30pgfgryrr44oy+wrrgeo5x627thz2puv62qux8n/ay0ovpy2j58w02vmdmczh6zdhelevs/gygzvsttmoqz3w+fpb3kv/wcsiaqwh3i3tx2kw6e5rdq2vsc4zkuwmoulasbafs3c45blt5o5raqvlhi7jgva3lsd7+izz0zwejifgczcmuoikieereaereaereaereaereaereaereaereaereay2o4wjowxj11lrzidpc+xemfr23fdplz3wddntz1x7l+1bokk+bmtzbfa/s/jxrstkcs5ljtl6c/ramp4kbfpgz7gsweqkaiw2q2zdluwh/apxjonnp4qyupjupkno2ga5tp3vdda2lawnbyhlc5inbx62utpigi4r2ja0aotzty6k/zx0tzldfdqh8sgipd88f+j1wda1wdb2k4vfjvla2iauju45wmbq5zujrzktlrvc3mpfrpmxhy9kt5bg97czwpunomba/twwbstncrknsnweol0sdgiigaiigaiigc294g/vuoxnhis/siagufnk1kwzds42a943oy8464lfagwqvyysdm+qwu1nqek5g7w99bm5877lavpz61rl8dn+qduvoxhqwfp9etjijh+nmjht1lbkxgf8jcrbj+y7l5kp4q2iecrqpk7nxth2v8vil9vrzv3j7mxsn353tef0x/nznyakxcj4htvjkkojka1j29mbiczrl17u3lorks0awjt481yzkhg5um0oxtednwsvhpgqeairw5mdildjibvder8qsfh8mzp+wu81p6yhnfe7xgbscl6lvyrwfltfs2hypdmtlzgfzb2+kcdd5kovpeksoaezs5cmrqig4mrdssjnneapqokctdj7d88+3jqvrx0qfhxecsxdxdxxh9mjbr8skqzxsyhv2zetb9fqttb+zz6q1gfkswo0kslgwiuunqlyzqncujmenyxg7mdx7udxst8vyvhrgpk0ojp5otuydxt84bdhgxkkrrnmma8mhelttpzwhc0xcbxwdfy3squkm/wwxg+k8yljeyootkmuz1hqddvgotjk55zpexuo7nfuoivm5kkkexf2z5s49l6d4lxov6ntuipdzir1nvm32kgft8fqhg+ztgp9c6er0j5lvtcvbqjrusmkcnfqsj62wmiy1wmyapvclenyuuxspzlkxxsyg7k6zj1i5laaxxq1qqpkdzkuvbh1fpwkhlxocunasdpir1rog2/gqe2qpflrrqnodt1dpqn0jggt0jsxch4lv08qc9jts5wb/ypptuzy25wnspr8svdvq6eczqt/e54pkkletgsgohpqeqpr6srsc4uanu7fmeqawuodiejjvaubs14dwu2db7qtcouw5frt8kcs9xtmbjnn5jzxwd6sbv1rclvvs54auxadqdakcgcltchdqcce2uttysu4kedospy7g5kljkdxfggv/zasdx1h1wbg+edghzncrzjpk4hpl+istuiv1jookaqefpx3kqlecqrewmciiapcvaogsqkqareqareqareqareqareqareqarlpdabfyqalkbxpe8nawxc47akh0xpdifk5rouyiahetudqbbantufnsqozmm4rgr1rqlsajowg+cb3radaq6scyzva+gjxdaegunactvxpmthli0dwveaiplh67g5pseh8ukonpa+famo6uf7flzmmcuscgatydtafaux8rcxvhynum+tpgdoicq8nxu9coiv4z6rjhktpmdk2/8adps57h1ddgonioiyvehklilya0uaa29uzc1lozlf6qirzvu+qqnhrqk857cfmnogekzgjaqin9o2wmjqch+nuxjfztfzft6lecfiuy9zukszxyjwiivnd08iiiaiiiaii0pe3e8dgwakgarrjff009d45c6kp05vjayjzzuvlmdi+nq0rc+aqn3ysgr3m2zw81y7gpstuyeig1nhy0dpd+kexsucxfgxzpc+r2z7itnpn6o8ogwllctvz5rbt7gfnzluzpqxepcbikdonqwhwrkib1f/dcfxhxpvkd/s33vmvfqi+x6kk8uv/rdeaka87ahw9epjfihy/m6fw/6rpbiwvtxix2zwacog8vnqxjojkcgiostp3gql9lr58d1finiprec+fvvallsm88e4mhxnfyppr8a/aci4ng3hntd3gzzmaaslu8ew8vyp9gvhcuxa2szc57yxlqgzypvj5ftwdvskkn47r8s1c4i9nss5f6vfqlareqareqareqareqareqareqareqareqbzrk1klhssosxguepp0r5rjpevez6mrzrkn+awxytbfqakzekbebcoah5udw6upx2wxldre63rkgoq1plmbcvhkwoykcx5m6olr87ldyvw3pu6sinvpcvz1w9g9hsrnbm7vnoaovvt5lwjv4remiwtqkt8ehinuentwfr1zmewdbxfx3nopzvejqxghmem3hutbu8hsank121xf6imk4hlye7sollev4k4pv8akjn5mk91xucp6gqeelg+hzqezocdcg+u2+67bhtv2ktxdagk+zdz99rx8yjjbya9vmuiiswtfylcaqhea7t1sfmkm68rlkd1eiiqdz0ffsx58gpplwj6lcrutooot/hdrnzy6uzyhxbyjwjav2/ufwk9wgn0bkwmoaqrchcfrqvpozdp6p2+4lsdjlj1tkhtiox28d1cs3ffvi+0jhpsykirk0rys0jufi4vtyzttwy2eregowzwkhnidlgmoblodn/atytnhlibmql3a1nvenb7ip7zzqxi6n3wzddhoigcxwtmfisrzbfrczx9lkxozybvxwpdria8h9poquu4vogtglhbrrmsoxehk4i/n9xnatatuthttfsjv3ibw1jkglyzuipjojhuawydwcpypc+qaf1gbbe2a8lgm4ibnndboyczn7a9aoazcdonzqrljnmdcczw21ufwkrejll/wsywy8ny6aq5kicmjoznwlrea57qqybhdtbi0yvyqo5ble4izmaaeechuhcoxkbfdvrpgt22czbm06h3lp3dle6npdpu2j2ewtybelrofyptnrbtrpxtyrjuhdniepbaad5xb/rtb4hzizk9wzy23e8l7toujaegssnub2qpzwuwyjfpzfciikktberaberabesyudx4vjmvkwvkdb6lb6zj0axj+iujjks3cbrg/kobfkpzyez13tijenvm0khd+tbyxj8whqgekjdtnyanbp+0rolw0jswx94zktzzefweul19w1l4jacps3wn23uexwu1piefrxmkodzuffz1uh+9xsnxiwnla5krmohmxsfajmtmjzt+pjx3s3gvlbr5joqwd64d4gjq4wqbsna7wlofpn6hblccwffpkdzxsewkhqi3tyjmf2th3h21cdxpiywkz7pwa6levlpw/xjx9c/qr6vvlyblerzxaciiaciiaciiaciiaciiaciiaciiaciiacyyqk6au29v/meb6hyyj8judyhgsm4zibaqhc9inj4gqnizfxqsw6vpjae5zowsa/ujq+9a1kxatupousr5gclkcwml5nqoldi0zrrmouuouazus3+k1vurya+bi9auo2smnh7b/fgw4e4yfvofnp2xrxmc+wfmcrrfqx/gy0neumydphwrseri8dm2sxdzbvtmz08so1x4y6rjyy2cgbm0lljmesh+cfna1zybxnwnaog6bdnts0p6sy9noxx1fqs5u/dzl/4un/8al8s7uvkkhjklfisb3csdfsv2nxeem3zvsto18526wwgivaitywzsqzt1zefedm4d42dm3jixokjf3ovypz1aor6qawtb7q5puhc4k4ddo5jg5hs5uocup8m8rb7oothihsrzw54gukeswnmfjxlooetdg6fpxu3u/h1xv5+zmexgk9wadaereaf4v6iaoecf8pojnw15ce5g6hlftqdz3xpxnijbbbg7tch2hfqzbdabhogyksd9uv49wzlg8ehifpwt/wcglca28zb6h0bxpopseh5efxokkfejeqhdpy7oe7+9mnsrmdk3putnxhwe6jjepqbi0vy5q0ti6elsbgvh45mvj3r96plffelna5ud1dorv1wpzotp7fmzvtrwtru0nhdc+59ybymucooikhue8ccgp7v0wkjzcxrkd65gzvaxu2ry8ksojql5opq21orkmprljwch4nwx5no4afk5sxx+/vpwsyuo8t8ptqmn/kdm+pvj3ep5ohnc3q6f8mjo5g2c3ml5sortzwtbv1ugk3uc1e2bo1w0vvfbqxzmejm3yulbixyki46ec1jsv5ilkqw2zdafdavtgv5qjzpff1gv1ovtqvncyywkk2q60khqubrslrfp4c82g/jznzh7ojbug6gtye9ldfkuehpa3ticmtunpmdbrormiemsmjjzow/xoq8p+t7c5gj6jzz2nezqtp0tf4rfty5doetc51ruudzo5nxwkstlhfqtndbkje3looqsolyxaepj6u+tfwshzguvow3+ciwj1lpxa5banixo3ou5c2rllyxsculmg+q46k9b9fypshmerhoasdnlr39nmmu0ottk1zyqjrsftmjd6cn4eyrkjjhzp7qnpyhjbimpgrgnywna5bxwf6ozsblukaj7wiimkgreqareqareqareqareqareqareqareqavmedsbxpe4ma0xc5xsafexnenz6ud4pxa4mbzmhzdxka+e52w8llrpejltnbvu7nwkerdb7l2mni/pbndifk5bhe02axndnp8azj0wtn43rxi3ygm1venoafinmtayybctiaoxw/rdfst+frss2ijjknulmtbc2s/a3+lcxtvmqikyzkleu1zfw+ddb7hhgsksnqwdjyoigotzyc8cvjq7cwtm9oh+qzwzveu24hievpgzjhinjbc9ufiwvo7m6kvkkszntpljxmncxdzp8/zou8wynm6oka7pewoyinsl2blto6nj1udbnilmxnynbe9spas3eq4zzpkkecxejo1ofxynlgq/rpqmesgndvxuqylnkywiipisereatheretnsoreqareqbjv9cycosv5s2nuy7a+a89aub4xit6mewd7txnqfrzyaoll0d0n4qr2fodyg8z/e7mhju74dfy2x4fbnt6cjdw+x9dpuamqwnylcpgut+n7fs1vjr0xuqdvezsk+qdfo/cvomrgu1xma29zv2qjsbenu8plpzz1m14cgvywny9yekzfkhcccul7bw622puka2kkzspgtonjsfzt4k02i3juiloggnifwdvo2pwnkhalrdqfi3xsksyri0y4fa9jvqffbddqwtzmjawydk5r7lu/rdofg11rct9bc/wabvxviitvff281ino58dyhjjthsj+0dgsgzxjjzfqog4i8fbshcs9hujnta3isy5u64abitcn+dqquprn76kovmrh7mjbz1r37beruiciiiaiiiaiiiaiiiaiiiaiiiaiibahlpsprvo8gr28sg1c1nb/dfyuaxvkzq7z6erecfuxfwsjtzzmxspxfzdhzh8whurrhfctac7lbo99uvpdb7qnuljuihsgtbb8znwvcwrna1kyaaladzbhlm0d1bx6lkb+ncsejg2mtfvsztoohkk/c3hnxnm2kqw7s2u0e7l2b/ohjqxo6d2yxkpkt4jtpsncnrfwwmqckby9zyckm87gtc47nbpw5llol+lsqpe2pdx5gm3aoufbzolr1cckq4mj4/waamxyzgd1ziw+hoxuv4rll6nrz859gpan2vzved18onunva8dlpgdi0equ1467efzgcu/z0slbwgz9veagx+brcrtbtmijlvvyjnrewixqiigaiigasmhqjg8o5bohvqxktoycxlcnzwgtjrh7dqd4w3v7dancp88duczt/v5fatngvu05qcvlzkmlh4ndinfnb6j1xfyvhxmijbfinwpo8xwjxoiuc4dufedfuu7futceswluxszsoilllqw0wkucunlbh9rhorsffatxijsxzxddpbhv2ulkeiaknmsxajnxvabobneyh+i428umctg11txwuw+q5rf4jkhzxduezgueatcuiysbkvriynyoahta6+hprak3kc8ildkmnricmlc0tdirl/ta+5l/am9p5pxv4yx7gtsubm7oxdm19un5t1exhhcpdiwneg5oyfhbkovitzqzjnzu8zyxu4touejkr02uxzjomt00yw4nurs2iblcnhmo4pnzuyw6hkdxb/nxgsixr7pgymuwfhzctl6ehdgwdg8xjfowtlvzbzooyslhle7i3hk4lomxzz5anicw93/tycya6smry8i3idw8tzwmsqq05tx4yjbnrsyreuy4iiiaiiialvcs14gpj3k2l29kz9jw5ezmtqubekvgbmonabcm53+lynrex1q3zu9dves3ia89mcbvntfn4w5b8lk4tw7jukafrpb77racg8ksvr85banp1cet/iuw4vw9hea0c9vjatxcoo0sk2t4swqfyixhvo0gi75c4kbrpf6kkcjr0g67lotnsghotggdoqchulu5fmtgntfhd6z0xaepc22j+orbqfr+5kbtndxudfarvcrg66lvvnm1wisklopf85hxdoxmt5kmilo6d2kgj2qsce4kyqqk7u7keycnoz0+nlt+oecjg59rhj3xg7ozyd1bujw15znesfved/3ltjonwm8mzvpulpb4h0oqvf4x1wd1apwxq5prdneiijbqiigaiigaiigaiigaiigaiigaiigaiigaq+n/4ph/9b9ukhv8b/xtd/636ow56p8a9ujd9if6kxw+qiiiiu8pngiigasypfjwdlleqycezdrcnj1yeowgrc77neejsfgmtsxusunlulhlndsexltoyno7r3mblev7fn6ral5yix2qy0nbx1lgg5gxs0rwg9ql6k/++qv/apu1b/8asz/5lw8uoqbyonunp0quffkvwofcz6grc19e3eulrhuwz1ek0ktmyskle57+zclzcxn7at/7l0pw6drtipi5+9tjwtevgfkclwr534o4zqpkupddiftfejcykokawnmrugiadztf2qovxvjjss9l6xuv5yjbpyww3+/3g+iuxy/++qv/apu1b/8asz/5lieeemk9sstp5qu0rc5k8ksoa0phea0nfud2plg6vwagluy91d0eqwvto4nnnrwwknk7xj2f/kyxx3acrdjiaqhctfy4wwysmpmrsubc0upd1af9gvewpfvlmqf2boneq6n4sq7qpbbrxnkuyum/m5afonosrx5xj4hqtystbu4n8yaoh6sscds0ljhi6owz7yy5getc3m5wi1gjt7wufvonvmuxtk2oly+r2k0r7evzoqvw6jtlpaok6f0gte0xvhjlfcz3pp2asidxodlgwt1cczsbzqfivfwveud2niaxuyocahofrxa6liz8und61vm6/wr5+1de4qx2lqagckoamsf4czhfw5yudvll8vpzxcj1mjppjs696p3fpba5zjpe3fnt9dsnv5ipliyve3mhzxfuybhxb5qtq6f7nn6wgxmk4xc1xde5xlmbuygcrwdwypaazbaxtd8un7wegqmimrawmr5bgcaex2wg+rw16nl5wd9h0hruh4/ixxp1yw/lj1fqvbwwq81ajooixwk6aopjpgmubliwjpbobhunpqu5+q+chtbxvvy3vuuyd8yl8mpk41ptkzljqnkm9pl9h1xtprs+viqo0orfexl9y5+edu02jgxijjdbkglztxewlcu08bgbpc1umojf9tyvlt8znes9zv0isvyp3n9wrzf0sqs19si9tp4/5htr9djrd11n/g2/9x9l02hh8hflaib7rfpek3lwabadysfw/wbh3fde+sp6c1b5onkh7jvylmbpn2upegw5qb+lxejyaon0m8kljunazinujdlyo0ude2gu6ulodnjgyknqp293g1clmw+v+fyj3zer5f8a31v//wb2rf8a9mo/zlr/akj8qmnpj3tves7m1jafm98jgoyz3qsdt/euyjdkplskw+o+j9szoutkaa2wf7tokkeekzh6ijpyn08vzpfoiy/kx/d7nxtygjkfycxjrexb4nop0xbn1wrvuo05awhnt+gv7yl40zrs43znb4fmfsyl5gpflef/apq1nsqjx7hmvcff+in1gkvz/smlf8cvf9vj5m0p9uq3+0j8mftil5/wz0qyhcrnlzutgmwzjqbed22n/o66nwrx5tv4dqexnhruzyct4xu+cpj4kelcwqpc5mq/6hdwcdc0nhzw+pfwywoipc4axjsbqsvymcqrcz4n9lmujdhrsbuyn0nq4/kafzqnx+8dxk5rifg1fux7svldt/s4j2tldcg2v7vuqxlooy3ogs/ru7uepsxbe3n5frg+lkxyzjk5xu57nhq4kn3q7t18sduznlji2mb3m58idoof7q/3fx/ynn+iesbvd/8ah/8asfvylkhow4nrqipddluunibe55mveedcawfvz5lz/pdxwed5f2nvnbn7xoyzjis1stsxb13ksq5i6fiymv9gqrvvzusy989ug/yooivl/wdfvx//ahat/wd2aj/mu5+jirklw6nflk+v5dmdli5z3m0zrxcdsm0bpvzauitqfqqljsvwu08vg3x/qlqiitgeerfoneveta2srgsxkry1trk1rgtzna1oebbrq6wgigr11ssbrqdl6xo/nkmzjywdz6lvba3t7v8xfvqr/wd7tw//alnr/mt99nf/apda3/8azn/zkv8ab4+rs/6o1v8aar+ton8tymlpxyrx5rhxsnknhcnqd7fclhdi9rlcz5zpke7m+ptzmrnx9zzb2jvugrkzn/kvpeghc7rtutw165tjigh7vz8zmuo/6pbmsdfxo7ry9n2jxbfozklkobhsn/suh4t4k+vpy1jndkxobbyfjzdbwubbi8ceapsuilsjkam+3b5ncvkfovopd5+b6vf6ilid0uub2t1a+wifbeijaberae4rexk57kereaereach9j4jrgxogp2ef23fcoktfqd8dv0d0md/aeumluhpmjn5pdsfafag3ut9i/doultv5ufczvx77m7ccomz2sg7uuw8sug0fagsbuebth71huccbk0ltydr+a7bfinosp3deuzyro2lgoju0r6n4dzlf3ent/csulg6njxbouxescba9+xrsqmqg+kzbg06jmq3iza5jxgkfbyhgefnsbaxuhdnftx4bruxhid2yiigwurbmu+yuzt80fa2aac+n1j32mcuiqvofj87vodsx6gn1virxvhi3au5yxtsiiyrnfela1rbgwi6k1b3jm8miulfri5xkfr88fk4gwnfq359le1dtxjvrpsb9q5/knmfzowhx+c6yqvumves9hhar1cherzpzciiaciiacl1ynvi0mxrsd2wpstlfvgrtlkzuwgdxdtg6upww1ocsimf45a7q3tmpmj0qu4rlqimnwzsiijhberabxaamuexo5ua+o6tk7tzfj2uguu3t9idhgvkr8bgn41w2owopzgwmsm0yebuys25poyk2mwuccg720ul623veh04fq5xahcrudjybtf1vn2beb9vsytlertxjjy8jjwkcntkg857xtc5cczo5b1abvunvv8adqcsdh2bnesywpjjn3hozhbykfdhnpyzqwtpnzae7xodwnfr+salhxa6bnyudllnocd2ky/e1w7sywy4lhqrpy2buamoz3tmdheqefljo7mby6gtvrr4rqgjxgtalbhuyuwgqyahs2+z6ilg2pcl4jcrrh/grj0d0cjjxcwmezicztg2n2kb35lc1np2yijvcszyjt6r296kdnrty5uuwstbisl5x+hd+ciu21rw/mhjh1crymjerzryciiaciiaciqg3qnynf3ongaoppjkk28irvbssed3nj8y/waf2rdrv1xksv47baskc5ni4mrh3p6o5qm//i1wxx+vv/q2a9y2banofnkskk5rllzn0hmwponfyncfshmlcxs5wnc6mf535qe4bxhdutvg/xng7rw8r1u7kn0mhwwzxxgztr9yxlt6gbwlfa0+k1kxrinollcmtweueiikupm+mfmjczmzvd9hmatoybrmzzg6el7hc/rxucpgs2cusc1w3ab/alcrhe1aymn5bwzxu/npzd0i1wjby1q9q+gxs0s9jmil46lo7jg5x+kbv4latixg3v0yjdgy4wnm4env+bcwo8zgi/hgd103wsxhhgaeuhu+bgle93rwhuqnywt6acetjgwyvktlczbgoow7ltafitvw3u9rhupbua9rpza9/gfzsor3yulwm/n7vm+v+guk4fmkis1r3naiexc4jntioskpwrqy8kp3n+hvkv5dqltdae0v+psro0wuh4iljgaxujv23uvun4lkklov1mjvx0sgq1/qxw/xr5hpf61ue0gbdrcdhfyr0zg7sfr8rxztghrgiiak5dctbqkrtybvyqhxc90jzfni4357don0vribhmc8s8sdkvpvtuvuhmpvw/l7cuisp935dqh29ysux+s9zjr10tf9wkv+nfl/adg/63uf9m/mbgy9dt0pxwthe8n8pa2pomnivrz+jp5zbtxnhadho6txpqjy9f6ud5r5d16v02m1tfzjir7fxt0hk/l5bnfjydblh3lpzmfnrwdvmi/13xionjnurznojoaxatba2w9yi9hq2bc5nncfi361svx4cytpnfj4htvrnibtoanw7vkdw3j0xioesw+rul53nl3tyfktnew7rre0fplka0w6wq/sswt81n1quppknyluuypdzqkerawtlprrlh/jgt6pp+yd9e3+burziaiubdmjpw2r0txoa6n5n3lvyjwrxc73tap0h8bzwl4lxp5dmmflltoemu6g8weuebnw4hi57tocxb8nejqnxn5d3gcvlknrk6nxcgagoyz7gzdcovbcdmui9mrkwo0c1+u+d7lsgd4tsdojkaxmyzrc97ysonxdgzmyniynl+2c2zgho4vopo6sw7jftir3mzokzydzozeolldjp1vfvumv2cd25tkf29dbubxfhz+88lplcciiykereaereaereaereaereaereaereaereafxxv8axtd/aot+qfqrvhtbuuhjpm/uc3fr/wdqjd9if6kxw+qieiiu7pngiigaseup5kt9a/ushymjote/xfviobh6aun7gxonq8s7pq85rxzai0vcugpikghx6felxbqtd/8a6ffoovzje72wsi/u+k82syfudsooyz3eda+jpfowxgee2bub1o72i7fi1vvx0ovk2nndg9j2mzo3ne09cdch4l6mw2te0mmzfvmjzipitv8aatkwn6rict6ww2mrcsu6w/ev+v4gs4xxb5lq1uonncmsj/phant77+xfnc676z8vs2lpqfwjqjb4awzf3v8a7k5ngghmoqqaec/asta79g93h3aqg8lrqav2nt0boq3snwl/ey/gv238txvyqscleegjxvsphwvilojp3tdlcawrgdobeubqpctxj7bvdyoltmb/1xlc+jynzjxwxymzskbi1ztt6hp2kk2ajxjnzro9wtrdnq6exb/q6tiuczigkme8rplte1rm1lhbut4xw6gxex9ndlmqnnsx1q1oy36udffqs+uwxkzbg7m1gt3y3flxb1tbkqooooi8rq2knovyaaaakrozvducm8ghbue247cd/l2fmcc9mgkz6mgnbukepo7+kcdj7gt/tlnlg3ihvbhihezu1vtpe4llc5t/oxs0e4bwsjizst8lupu/asknd7tcqpm/w/6hq1wr/zpsjvo8in/+p/8a2zgrfcl1fnuyfntupmdpf8fqkulji9vr2nly+tvunr2ckb/ouf/ln9zs28nbxsz2eh9gj1kjhq3sjap78fkpvwpr/hy6i1x2qww3v5hxas8eic1xh+gm/ph/akyyf/dqf0sf64tef4ab+kf+smh/amnb/sx/rhcll+e/+l8z6ih/4cv/ac//ainxgql8xcqgmfj4nwc4flxjdrt8whkt+n1i6icrse87myxnya/yus1nq6r73un3pcxe+joy3uq3lpqui8v6hmvob0mf3covvwyw7ecnx8ufkwlk0whytoyxxl5522hmespoqv0sji27via+9dfwndi6enrgnaso8/mt1jwrzwbrvl4r2/pf6qlpsvcczulx5jeb/jesw/0xvcra+7gg7bfzp/xhv30kynl3dpr0xymbyray/o5hldbcr9gt0f/grsroispi5ohph1b4m5/dcx9dlnahcmtdvsy1qay0fzxobuhenujpspesj0vvzxustgnnaoas4beo7s/tuirk50ti7kad3wc/mqe+ks3ynuuvylnd0/k36p1w2vk3kknsuq1b7q9kc8cpfjhlf230mfxop/4s/wbyxcsxx/q3uar1dc62exut5xyn+kzbjzq/bnzeleswdz5r6md6z/4ntf8afd+6eujlr/pgri6gglirlqmxj5/knbe9cgrerfx5c+i8lkwwpn/u3uccogpyxitkgvykc9ht71ji/rg6vhdbwnc8dwf4acd00uh9fuerzumpcchcpca8b+o3t4qeydw/hc/ohuc62uxtb3k9stredbnp6shmdr631k36huhcsdnpznlzfi+aa+hkgkffkwsew2c0/woqqw3eh080u0zs+j4e32cj4hue1tl0uoz+6fm2zcbna2+ndxsfgxhvcgayakde2l2o7tkv2q2joa+8t17z6toaosxrst9wvjzg+rbf7vyl0o8aue99dtywjybvmjtbo/8akr9bz8fjtb90tq4nhidhwuubw3/lswnad7sf89pesssssss5x3j6q/d1moqk5fjyfo90ye6868t4wei+/wa/gvqelcyjwxu1htdcsbozhamhtvfceaoraqoean9evw5rjf6wpavo/d8ojgjbhfggnyaaaaosr21t4m74njrxw1zyp01mb39irykm9dc5f31bgn6lrf43vfx6hahojjqwp/nccpiu2ir32ol5hkr0kv8aods92ec89gxcc1gkp08ya97msby37gg49ppuwn9nn+4f87/autrknps/3d/nf4e2vtukdiv3utdkup3xvo1qnlz/ao1njf9cei3/afxtfpzf37l89r6e9fv+q6b9ob+/cqtj/m+h6g/6v/0cf+jfsrmkrwp5msaxpcgtbq5ziab4krwppgy6vl/in+pvv/ezf3hxc28cwmsxvnfpclgoprpk+jez5wxb8fqwyvvviw3bjpi9pnx3s8209qp9spzhgopht+htxtq1qqg87fmyvpfnexmynzua3m71rc2utygqyjckldigsdwdypbtm13awnd6zf0h9amvmcxx2nixtao/pe3ntdi6fruytlvzsn9nfss96xwo0rvpak28rpfbjm9hvb2amc2kihuslfkihnbdaghdzq9v5mwdh3rjr09i6fxdtuhqjie3dix2wutjjgyjct5kprvtui2+fn5fdhg9q9ouqpnbnlzxlsnns/caerfvhaheraberaberae4rexk57kereaerearfjjhqsrhy6gltjox91twlsi7w8dgfyumsu7moeyrpy9hs5jhzwd0prftcdgdgoojhnm1j9wuf9i3duewqamkzz4wcww18j27ee8yti1raiklikttq9dcmg9g+dz807hzre60dtbdsasrqisqx01ix5dz0h19luszebqw2hw2fi5ppvdut3jvx0cti1v5zna3j6nqoqk06jcixfnruykyhx2ea5amhcy+z9qzyvspjhpeee5lgszxjej+h82nmo9jvhd444u2orjfuszsl8lst7wte4om2607yoxm0mkske5rxtiedytiuc0+1pltio5cccqbnjro51lksgohoqx8nkl7iubz22pmhrxifikc2zdigu+dtcef+sh0xlsskmk9jnxantq6rrfmhqzi2hvt9o1zxtbsxninrnn0wdfhilctvyrkj3acxu/yt1r8knlj2w1dp43tgceinwbexwkngmjjz3iq1wcony2m70cywy4zjclbxynupw5kg+gnvu1vqjphfdaxpu1stcp+snrrdxvqu566rfwguo6y4ciiregrf6gdxytbxniblndywbjooshbacc7n4ec5tjxeb5mwdvx1kt0lwvr57enssomx4l41orwujhtt7aotljmj9bnxzwnj3ibm6oj00911t06mylckeputk3vjubjdzuh4tle4py8gjuwj91lglh17t/h7v6ggc1jhpybujo2d+kd+ynnyhd6tbb2+9+a6bqylho0ojfmhmcx4ecl8/zqdnfj7fjueeitbph2jj2d8r/i6xpw2io17gelmcwyencstxlg7kiag6g3b1bgxftwuwiaaresabkkr+9emggxuxf9fepvvza5w5tk18brfp6eh4rixwgse7zrohkvoukspu2m+ccuupo1vtjb5hfovlgmuxut4q3t41lcwgrndg0kkov2gf+r5rq4zhpkd2js/uou6jjyzo3pm5kv4xryc6oidtnfjkyhz3hnmtrc7fwyr1bljg3fhswsmt4oe8t7knzt+cxxb7aoaqwvesji4ktltxr65b+hrzvvgdegjniep0jagkx35brta8mlmsskkz3riqiknxv3b7kp04uo7brwl6epashrqsvd3ttsvoal93vpvx+tz1o/i18m1hkypzip/z9i1l1su55uyv3kfnllaciiokwreqareqbwxo7xc4mawznyhzrepug4p4rfjgy4w9lcxhk517vh0z1w34vxzkubyno9bvynhptrpxksrxuym522azkb0stm0oai6nyylvnqedgkcsbms5xokg17x9i8bhi4g0avtwir2pyt4d6ld1xxli1sk+eauzhbuhlz4di0sdi2v7hn2c2/vwplhsjdcsih0srn7hq6doavoleczroy8kcaxzhsu0we40axab+mlipppy2cnnb+duyxzxabfjmusy3te13rwpmc13dhtgjwwyhs/wao0tzxsuben12jpofeqv3qthle9go+5sf61pjaautsbf4bzmkecdu1qwmj+y273dwprxafeomemif3hec2jt0a+aobfpfzvabjhebkt31m1t08ytfktz11exjmsfi7mw5nnaay+bpvr/0gbslpg+fwiive5uni7hqvoimblz3hnpa3w3uotw1rlzdbivurbmxiohhrdg+iqfd+cvwx8zn7pr06lzms/u7ewg0pfc9w6+yv6mw6r+7hg0766nw8vnmpb/s05arnpicown43kpw1hc1pyudk82dhdx9nbx1slq7pjl2gomtadrcduyoaa82t5+zutng8dro8zr7z1vmnl7xonh9sy2gwhilqrowpwscr3b5fdncdt6rvvjzntfcrxc/vmlos/unjao56+azoimxsyt56upuq1loymek5bbunlf8t4yy3etqqpnm/wutxc06s9d/aq21pxuvvprb8cxb++qmda5vvv09i5oelzydsaff717hxrlpz5fuuqopq1po0wai9hqmn5o6wjuh9ixpqjxrrgm4mcsm4dvfuh87lcrymw65t+v3kzqv6nv4tw/au6/rq9hfgv7dkq5ybmb31f5df6j7d7frhjq519sfgqjknor6ipb20myinusb7d4qmcy4w8iopbgr12exoywprw6lzmn03381kmswds2hphnsv7jw1svidcuvsprj5v8dofr+x8stob4ufxmwjwhrkogc9uzscil7makvcb2tz3wdfigipjvbqmjahanjka25bb175rn5kt4k1j44dlbhyxta8awblbfvfydwgtvqbe/uuqk8zb5o0hhquxsqopikytmjajtcy9ndgzr3s03obs19lkofj5oyifcnqd9t7rir8ojjftydaoz8fn4ptgc2w1usglmu9lgmlkkp45i1wye8ypfibidhc2byb5k5dw40vej6nkkgaa2r9hzo2fha/mdvj6me97k31ddvkulqcg3fr7fcnuk45wrk6mply01pw8xl3mkjjnfybaz48/atbxjh7w1og1r/2bztyofvviu0/erovs4zvfsyi7splp/cnoy/n/oa5qtolvhkrj62s+zky27mea3cmp8lg/wbixvdk0zewbnz9fx3d3q0s6s/xwo9oreuioreqareqareqareqareqaryui4gycn0jzo3lolnodyxiejookmd5ax4ijgzyxh3l+5vq3tz1t1svmiqvow9516xeowuyoqi2u+i5zqfjziioonx1fvgv81pdids4nnck++/nzdfxduwkgoqljts0pox+yddt0vyxtntpecu/nh0wi4/h/pvqw2e0muwgmdt4nnxdud7gpfhpphpjigvzu7jp37fl/wbpl7vuqwvwhbpujo14sjmze52gp8rkrjh96tdz1zh/alqrnrogx3ejfyjbggtd3l7jzxvf781fhh6hx/7qtrodprvwewyvpa82c37vqieiilszzoiiialbxc/knebfrwctdjtvyyhvw+pvl+wlao/91/q2pr+nr6pbr/8a9ifvggxqcfp2z4hxrj+ep5vlgxnybpzdrohbc+w/wdzhc/k9zc+yd0kx0tqoa4vplt9oqsh/uv8ai9y9lup/2da0rjgcvi/st/i0c776ksr7xdo2e3npi+e+v8zfg8e5cci5dncuj+ivhbamsa46np/lqh6aob9zvuuntlw6uh7i116irqw109+jl47frmg9iejdvinub3be75ozwdryj+1nw69eof9pvvmi7tnhofz3ad4b3vxp5zs9znon3pcxopuk3j+k7x6kcj7ghehb3ql5lvzybn+av7uw6dstqfvg9ymrlpnhr8lbfn+gtjhejbvlap8a+knp/lp3rz+j2tlidefz3n98th9qwelgwrq0f/xeh97v2qvg6xlx0jjt/pdbfznvtus2q/h8zrqlxytecp8a4n03dq70k4gicpnofk+tlhfbqkk2cb/vlljmtr2wrsyubijaxzrufal584y4glq5qzhmw7zyrfiwhyaexblvongvtstvizzhpky1+ourzroxl+ymd3n34x8smrdydh67vjo/htwlwypmvebq3sr2ub5rc/juek1qngv4lz4wttm937vzk7h00sr696f9msoanks1bpeqt+7xfbdx+cz2uhzm2pmp/a1c2nfiolag9llsbh2a/lpza5rdsquqlw50nlp4b/eteiltew3tyw95dtogut08x5xdfnj4e8wspzwxm+ogr3mnln4latus4uqdzizz77ft/wakljsuosa3jw8zd+h70erekfl9i6lvpljov7pbr5zx8dm+ifw039i/9zmp/hof6vn64tef4ab+kf8arjqfwsp9kz9clkjfz3/xfme2w/8adl/5f/xohctsltjny2zzwn2uasuaro3flb0svgwh/uc5yr/wc+mvd+bob9asfyj+et/sjjub4q6plj8ymkedwpvxswvzpgeynqsd8+nwhmcdb4fdjv8abx+lpfz9vnnmembkupvpgmopd/1yb7bstecyimdhr1ze9zdru1ev5mu5jdt3k8vpksjbcoaxjx2be4xlug6bbzpnoorzgvsptcepp/oajndunempsasor6vckbfrxod3emoa3w30ha/bdvc516y/4jd/ams39ryq3vstps3nnodceb+k0u5w5dh9hmpbdk4btnv/anjdfzhdp9flf2zjmkkdts4kd8xul+sz+mtkvv5m7p0vtftmo86o/u89j1u6wgf5sg9vynuo7+tdpb2lmk6r6vmhmmelg/mw1gux9yfk3hxrsvypj1fp1tvjdvrjsxtlq51s+pn+d/sj+50l4fkpbh8hlz9t2e7qlwyhotrippmqhtigo46cntthvmzh4tgud3gqcugavnq0vhpnytbylzbwzdpifzrclmgnpyhxk7zgqpihmovwqxjhpyvt6z0+rxc5rtn39zvf3z/is1vu+v7pjhl73kufi43jd1jus4j4hlrzgypbjgy4eyeevy+q0c1eipc1wclxabi4dhfyoi+gpr9xxhwwfnztimgabjezrrhykyoq0onl2hotyrnu9z/5kpxrmtbwr8goz2b/amk44/psa/0uy5mpiynn1dgeeay42/7qugruppjijooj9cpat7woh2rhyw9/mjprjh2fy82dx9c1im1zkrqbhg09bqt9nuxx1yd0k1yzvsropbhk0dqcq762+9dfv+0x4sos9itx9otz7pogiirjibck9nn+4f8ao/wlra5j6bp9w/53+bvrv+uza9hv/ekfx+josl6e9fv+q6b9ob+/cvntfqnot/1xtfpzf37lssf5nw/q6n0r/o4/8s+kizk1nc17s17gva4wcxwbar0i5q6hwseecngujfkkbnqu9oc7hntklzndvx9rrnifzkon3v8a0nfwuy+kjd2nkimdmh0gypylam3z1xmf13/po+tl1esla02vpuahohbw6pcxepurgnts7fakusqpaqwyvarqchobhkryboggp0av9azp3im+iz+2fuwpbwtxwtdfnrvv/md71xrhtlgcy30lftzwyt7fbmssvkjixome5x3c57it5lzggzu7vgzuin7gknkqf3im+iz+0fuwvqybi17xodqg9he8ulvfavn0+9hxhkuxhnz3/wazlut+knqq9hwp0akxouwl6jty1tvpn0iiuypeaiigaiigaiigcciilyc9lciiaciiak2vasts3qkcmkan6lgruidrszmcx1jky2uxmcjbahnywxgkajultcmrh4dqvfk5aggwewg7x6aa8jyvqnpylhp1xflzdqbkmmctl5y25w36epvxs9cjb5bk/fdbcnigilcduibta3inwyqxhrxukt8jszjoyd1ty2whuyjli7tzphpy7bxjt4btereggnydurqivel8js4hy62tfdlnuk05lfkte6rxhsj2sdduwsb7fz2ywru07pma7m1jgc0m/mc106lf27wvpzqjho8jwq31x5jbpfdmi5rxilpqmpnngqbg9o2v857xoyspxjuruitcn57race4wiqhhzk90twe0ik3a7iduo1kldbtxyxh2vrtl5tprxuf0g7vxaadtsptvmnvnkauirujtjgwlywwg2zi22tkzb/uj+0lxxj33c4+p27fbw1mvjapnjedwiimchajilfvk8jcdzztgnppufufzl0h4shpbe03een9fn9ss2tlxkixyirt0xijiemokce9cn8xk09ruhyg/u+pruvuuuhqd3kzqroke0nbmjnguhsuuz2hj4m2hohygzgfxpjs3dpr5pjz0lmd4+5tthdhkrna5zqxo1ph4lofprttss2pdzk2ocgng1p00te7or1po6nhknz1wuqeaxtbbdvzhvdznkoiwkujaqdlkj1aixjio0ppej8zvfk6f5y4wiox47o2xuawi3u+47wuamrrdruvzuodz9xpzwjb1vfhnuz91q8kfsfb2jglhdpaynou+cwaezz4+x42utxdofsznpphipvjdjg9we6hdxikdg1w1dgcpkyyr+jonqxd+ppbz1rwyperxc74x4olfnhpmxdnjzgea+qn9vjv7e3lwlhcd2svkigss6h2jdlvylm2rmjw+yscr1lpchn8oab9i5bwzwvppkyaozrxrud+9cypiowhialpojkyul+e/wcxxju4uvpi85epapvvjyl1g/nex8ffba7mcogvmd61ez6+sf2ydtmfsadjinvrnid+nk6n5olcpqjzhc4kxbtubk52rd2rjetqh8blr03hdhczwlzutq0/e8li4tjj46arnecshyi4apmolur9il9wckmygup6c+rlquuamabtzod9j3n3wwkscj4ppknlavsm2vudjybg5+xutdy1vovloqo2uyx0rq6t1qlo9pi2vgva11uakt/wgrukshlvhvlqk8ymctyn1bsdrxvzkxajekapm11t+ua7kq0atvba6ip29sf3ulvuqvl78ki4vqpx961u/e1oy1mveetw33brzivikueumy7jp78obn3axyf3mbaeks0+nvg/w2rrqdyolag7/d5k6idhfzrvq3yaxtz3y+zwoczpozka8tuhblpgk9k23ih5xxh4cvkzhk5ryh1bacrfqx9udflflozo5ze2azqee+/1q79ipu1lll9pwpdqrvqihsl+rax/ehvt5jcblzylef9gfa4a4anrmarcde23kttr1oa0kny+9dw9gmylxptu7q+zqnv56yyrq28e5nvsbei4aia9w2llu6hhokp5opmppc0w2vwnueakxussujcesxfhggrhbja8rb61xpi7hcencxnic+mah7qtydcvo7eq2cbuaaozed6uyi7vbrd3exrqtgmyxyybvyro07yxny0jrkcq4j2ixknlmqu9axi+z4zid5es3w6rf4bi0lo9skuharuatq3oeqlng3aas+ro2knilpavwlxdqwj7fzihku2x5af+1cp1fnzjyvj03ful4z09mmgcbwo+45g+a3ogtblyxan8brm3d+ifpc29inw3+oqtx4pcehuvmdf1dnx8elvz3og6r07wanqfdzs8wqwpdprbcrvumfjcxhjyzlj5bnxvouces0eslbthrxszelsbsfx0vllssd1z7e8/isikmeaeizxikzmdqeqwsyc2udaozvpjqbc/b7lrcbqgxhgbvzb9nsi28s3vxvw9u429pv37l2k1hyo7q6v91cs0goys6aqxsu4a6dxxxdwjsbndmz22bggt4kx+jvhntp8asjgxzm7l9oq6hw8pslilmob5osnnoi4a4v5yqn8vud/b2nkeensuypmz8zbsqvyqb7kc8tciywpzgi5qfxbqzzvywogfatjb6zns3tudr1usk8wsiss5j7gldumh5lz0cmczsbo+b4nzwfjggxjvvp9xvlly3nrodzhi9qfjpdzrbd1xho28gklpyo0i0p3rzcs4v12wgrgb7rin2apcoy5o+kkhclk6dpb/ace/kdtftdnvnj+fn+4xeqwcasdwk45mmlp3oi02/h2kyyqxzzyjqjggw9mtldomija4r5g54alglxf9gpbtycgeezqw6309xcyos1lvryb2wxp9fxhufpvlf9dwyhmyq2nxvk0bhtkpv+6iawhcnqdx6km1whnly6prp3b0ph1cz4iywahtze7vn9njykg1ly25umlkvk5uhdvpgtjt5wxlfjurxxdaadzbda2awyzljpiyiyawzyzre31atyuypuhryxqy8hm0dpucreabk8ozopgk9c1d6iaykgdmy+o0u7wj5lwzaanc4c22ow/kwegjhmj5jansl2v4wurfhse0wlbc5kcrjaxxjcxkwjouu2yfkditxkjkf3c4rmvnelgm4avf7fjq9/mdqpwpkb0v+rlaby8+xgozjiji6vkchy5zhna8w3tp9sghh1h029o3jizx3jpx7tvgqfqmexl0kbw1adxt7pkag/rwg/mt42an1crvfrmlq3njwps9zzxmina9st66xgwgtmnyi0vqlkac5owv1slcwy6zjxhxs7lzrw3ig3tqvtc7mrth5pr0upo211erwfmlhfunsm86hnbchazckxletsopq9svrwkknk3wnhf2la6sz7mocnuq66rrcu4o6jp+1grszbm1173q28bfwirhqwrkqa5ksrpg4kxio5cpv8rkjky9hoz+sbe9r+p4xfrfgy6v0bidu+ahtntgoywmnsrmctqdsfd8badlozqbz2x4nox3pbroepswqx4l4/otfpfe3yqk/wdw+uysmnu9tefik/yodduk2dfv3ep2bxo2n91b/sk3838/8jefpndrbth5p9sz/k4/5znx+5eioz/ks96hgnkt1ff2bs4nzd6fbjzzl5/5cr9jb1vcjhf2p9savmiqqszyvulg76vf/yoa59ixppc55zs0mzo2mkvmpjk5lq0ljuyroqy4jzu43ygxxucf4ggpmgza959z7gpgsqpb29jvss+86+2lxqqtqtj98hkcylr6sb0xewjvsybdr4glqzuhylftjzjv7l9ltwdlrgnphswur4l4vhccq3kevgpf4p0lrssy2j3aqxd3ohnk1aiuvjyqeyvv4+qw7xbbhrunmkj6vrlvmyae9pb8bc1fjnsku6bg9zwvii3k8d7lpnhucq02vqdl+wlacbbc36vkrqw2mgyvjcbser1bc5faf33gkgyyvgzzu+hmqovzhfnguvoqo/1lgp8aw4/ucs2sxjxf74zm9xb+xzxu+qi8i9lcoxt+/ovf0zwgreqawrxw9xn6x2lalt447+dhmvn9velsfuoj9eya+s26/wb7pytzp1ich/gh+k761hljmkh5jvt+tc96pl+pj/7v5o9k/wbjksdopr86n0jl9ts4lflleor7w9v4kt09w6ptmpt2jde79akxhwc2woreo7+qfr+xaduurufcupjd9/n+2bvobeq86psct3fah/6epwwy/q0hmliib60r2xjzlrx+k+mpckok7szckaezwdnzuy4t6ksk7aubirdtmwyh9m6nhxd7l1/jkutoqgtvflykdcdvl0ylnd93gx/tk89bw4/3yt/fnztjny6aonlcahsyoeqnhc7bykbs9h2s5pv7d1drhar/n9ixwdltqpqupjdpp8gdpzn1+ku2+zul+mtsnb1c6c1vnno54nhpztese8bqqexjcjr33kk1vzxad4a2b+cl0jhxqmofqyjwytgat2ho2g5bqerx67uuzknf7pdr3bhef6orsu4zuqi3j6kx7hit+w3zpcv5m8hf2xlnwylni3s4hep49qkgyog+cj6d0inzs8scmt9i76uemtxpn4rwjcmsrtec7n5229mh8sh3/nd/zcimbgjopgotxwzjhjle48jr9qj6n0pwsfolbwcmn9fptgp1i4lqrqjfpzwm745595xhvr2c0buwazvi6faugtk5kug4xu9pfg7cltj5jq/urpqq2vkk/evo/wajl/0h2oj0rtd8wf1j/wdl5egr/wcfl/ph/rlyg/hyf6vn6wsv/hzf6r/6yup8lf/sm/wcxjfz3/xfmd9t/wddl/5f/watptdt9pfiz6tc34brlj2eegixbsr432xwwlq3irbi1xmy27xfwghi9ble6vaupbvi8r6hm/ot1eftxlbvxim8yfzsx6/or2jqnrsmkbuxwcpuxbufyo6+mstfly02kzpnzw9ujkufrnwzf56z/aqvd4x7fzdor0c3zw81jwl5khllhnd9d6bs6kozziceh2a8n+/m+po4w0aawafgfwug0fpirwi0kfpn+flfg4+dnw+crqptnwhrlltr+lhk8+y7wvv7bsox/wbwb5pgfjzzt+v4hb1zr0x/xgh/ailv929yno14zqayoqy6mysxibje0nywms6zg0aa+u3e+wwx6y/4jd/xlf7t6wpuvsg5iszs6lp1snrqyzlccbo4cu2ehgf6hu/8uf7li4mu2+hj+j1p/fo/umkjz/ztqvsb+gl719r6z/4ntf8afn/unris7b6z/wcj03/fn/unrislz+ahoz/qr97+p2x0o17ewmhojjmzgnkrlald3kb8s4dhv08st2c7mni+wu1/ihcw4ehcyi+uxtu6cqfmp5mrmhhndfoaosxxywtnadb7fquqadvf9mshddruj0+qvcpellk9x8qyxlrnniswulspehb4ksca418lrohudaoqmgx9f3m+rdt7ftx7hvyyhvnto9/bn8nak+8lrsg3swiv4dt3m9mko3lp7jx+qpojisrv9hvwrscr7wcruxbmdcah2l53it4w5fyv9aswrtrsuk1nkyckdrhlng67nq4+9ctx3d3ryocdq9xu786+ojwre2uuhjut0uv3x5neejhvvs9z2f16rk8xfzy7x9/l5/eucly+6hqop2jmg92wmfoiprd6ipebfsgg4nfuxmmhlekbxcoh1ecj4l5wwzwbigpo3f1puoiv6zbzzhfpmohvc3ufc2fb0nwuik+xug8tw2/dxt/u+o0xeab0y1yfn0tpj+co0yt4nvek3vemotdfjt00xjlke79a3wv77bs/aow/1zv84wvfk7kusemz/cp+d/gwx9h3hdpoqo1tu0vjla5rnbjdkclbrwgdm0+9az00vbghkagiug+hcrcs127muh+o7pnvk26vghnrvhoce2laotl6e9fv+q6b9ob+/cvntstcepk6lizdbunzgwulwmojx1dc6kxopkz7aqqc8you65yvb23vkljou9/c/y/m+kl4vnz/aou8u/nbp+jb/lt/aousu/nbp+jb/lv77dt8mcr/akqxnnd5v/ljr6rmza+rto0ame5px881vvc43p67/wbj31qzu2jcamdnntkmspe6wy+tkyiw023khs/rv/td+srfvjrlz0nhom9yj6g0alhrn3sqtouypphgz+ah9zv6q+ts1rbrrwptvzv7ss/shucj6r1gjawkqmd32l3pn6mxvv61kdtpxfnpu8cv3mksko/uxl9ie4j+7ev0h7gtj+37x/e+x+zxf/zx1fzp/wd7p/ljeiohfma09qd8fwttpkycjkli2n2ciiboreqareqboerf5oeyheraberabx6d3ra7zdvg+6xzp2rtl3ynja3v0jygta6k8lrkliagoukdxewpyuqsc1jydtgnypeqxqhjvv2q17+r3jywwuqm1wxc7c1jw1icphmrvtazvl7fjubtyhilfdnfpxgrfkas2ahvyc32pqthiekzxs9n/btaaagi409yibsindrnbm9jmnmidmsjafupq9cptg1dt1latuvppao/t1dyygm42fl1gvvt0oos9ppubitupmxyui4m5mvcxptvqb+1qphei45j3ny0ubguyfn23hvderece0jc2eb2ul2eadsq7vc14zw99e6jrm08rpnemjhzb9r7nxtdonrnw0jrru8+q9yr8g1abe+ppcnn2nwk3metgyvbdtmxhx5klyltujimhgx8nzw09gwzw+52aoedndipmnw3shxvamncefljjxslgt8zbeoikmqberaghilciynye7dtzsud4txgsvzi7vxjphquoekjeozp2ahv5ons/aunsjlrk7o5ddvs9pppr1fg4lmwc3l7r1yo63rvjruv0lgvaletpbvpg327qfwrevywd1naffdlo8o/itjenzanamjfwatrl6j99wxfrxcs2ffzc5divultc0bpnjdhu0uapt6lfuhjeblmy6+2vzsuoyhxbrwgskhcmvjzzkltulxusdwsddeaybxxyfsnyb9g1z+zbvqppymsw7h18qoyunmdwgx85qu9ottekrb6rfqqmugmiowuquw3kzlvm7+rkjgp8qpczgsqha1nrp0v5brslgs946mjz9xg8sya5zxnlb35jyxemxozhlltbwxtw4o592/vgzc+qyamfvkhbhqxiikvs4eurzg3mji/ue224u9rb06mm7mbdtjol7uailfort0966xwrx5g2axztfmh9qtaoyx2psy5lebbvtsgazz47q/vprqleudmhnxfqnrse9id3tliwzgufi/xntstjwvjg+qljnti09nm+mde3uuotpmqbxvenqwua9ri1zchncnleg9wfypvs9onnwprgrkastanlsfqzgafgfizbalv8i8xxvr2qbjxuzc57qawaduhy3lxgq46ldquzqe5su6qlwareinnbtxsvrm4fg46xjxwhwukgjzajfwv35ig6mwtutbzrjpst6lg1+gyq1tyg5rv4+9qj0h440vztruuiznlttm5nw34o4/zbekab8m2ybdxaxkzjy9znod3nel19733utgztw5a5gfd3cxormsqzc62w6wxg3cvmzxdl9s5pxzrfn4/uqoqixu03cnrzwvldgpvpkcwjpt+njggrzpsoacgnf7bxozr7ssoi/ifzn6ou0uzencuvvda1okn1ja0dm45b+icrp4aw3ba9w5n1g+jpnrykuaeip6t5ephq72ctfmatri1uti3xx8fcrtlncg1yb8+2vp/rc1vrjmlhgmfsltxub8jke/1b1ff9iy6+w8gqea17/wb4alxnsaedvhm07gprn+w0bz7wc77wtwu1bs03bslrpgbwjy1z5hui+a0alfprmwla5f49119dujjyohtukdzqmvjwrvkpdyzlpbobvzu7vgy5n213jl4eth4ta7kg0nya7aswixdzsvuoaoofwdus5fr8ov7p2s1fz2rbzz4xucsxzdwttybt7hbkprgmdmzg51+lrgewjkpnyw85h+gspy1wjmhbpkjbf29igz1ju0g1w1v0rp9sjeeyjjc5jzhgbi0wniayjznc1j63iwsugzurcxjym+4db3gryutg3q79ofutae6axuom1szus07so7sxzns6222q+d8cwwu9xusgg7w4hgt+1ft2imaavnx0jx5a0nk+mh3hf4p1d1kukin60mkqjqezmjb53+kn9mqw3ezoya3t4bbczqd3iv0lhsu7sdkdtgbhysuk6rpfrxfdfq5rrkx4otdn+dm7sng1maedvqvtas/rp8ay3t4rlpuvnvfdicl4jlhydg+b+pnxo4xyt5lw25letmalebkz2d4al6dfkdtmtufaa3uzjwj5duxqmklwojkqkg/qg7reowvgn1bnfzrulq8rsibe7tbbo8yugupo5e2jimzo6icnfnjh83tsfvgl6riop3uqtzvoy2x6no3sbofvbqhdrl/aenzs4xprta6lqmvulb36szrq/kb8xwuuw2pjqgcsm6hdvnrvoklkp7l11jmhrx5y+6mjjjjizzupc094e2j3xvegigxfxagok7zm6b25rnlfjpp5mg09oov1uhb4illj8cly7iphewycaewanzh83fay6buplnv/wbpfgho7pblbhgclzh1rkj7rluy2rhanlt1a7yqnxt3g/gs06rg8s4ohy1qscx0jwga+s36jvychu8njvckd8servmyd3houaewvmcldpy75reyvy2bccsgvskexxhlqgva1+rjo4/yogpsvf2lphoypcsltdtwird7vufp3srz5rlm5ylumgb+cuxejae9ni9zropclde7mafsntmqlrtlrxiq5rvuy1ounnzt2n/bwxaj/lls8kzu85zirh2n02x7dyfgldiiw69xurs1vhll2lrhsiowwx611vtvyoolheejj1hvwkibfj7+y8qlo1nlw+crov7a4w2g4cfl4bpjg2xmdgnts0+0laehychdm35ruxkehwrrnl/afjmtgm2nlapzjg2bqs9w91wryga39h5lfdpoo636p3rk7bvii/itpieinia8ue24ggft+g6p05njezv45iyahm+3dh3kiusxc4u66+y6sylwumcgja+3u32k2lapsonx9bks4+zzrs2xtzptwp57irpji4f30nh61nx1dhs4/fa+gjthf+jm95/aspy7kjhfokfkjyc9nqujyxet+plyfwxx1tjz6grr9m9he47v0ynb9hv/hqszx4hiwxvni8a3vly6edlzwjxck8b9l27wb8ctnwbi0maqdknjmaggzhe3q25xwff2fipxhk6b0f6sqmfqnjtl7+0kewesghiy+dznbv6vradimm9uxj9exzcmntjcd/hqlax8uxrusxynaajn/asb1mds86adlfrqqqxspc97sznhm48vidkqvt7fxqejpsahxur03qdgi8uxl5fawjirpzpt5ffzrkx5u9mb1c3xwcrt2kmeqhqfoj6ldzlhjnj/afqvxpsifkowxs+/h926jgn1l55iasefz5xhlm9sdgtjigidmx5v3ndxg/ok2paktaunejqkayp7kns0bzio/nslu5j+pul6vohjju9esxor4jxhb0phrh1lfayfgu4c8snnz7am6ksmks4dnfmxskugky7uob9rhjbnrllnmnvc7bks2lqiwlw4s2qwiwyavyapncfiim08oisndo2yti5tih1rnfe3aizpe2plfvbjefl0xb+zutditchxubf7/jreyug6fdtxti+zpsbfgbusbvkzau/srtv0vjq0w5hx4ht7icmytsqzeao1p6mw6+o881ea6kydvudgdnnotlchpjuq09li443jtsvoif8a1lgp/dj9qlgerg7tbsdr/wvocph/angwl+gh6gv6y/nxmfq/9jp4fvgiglyuborbjm36tb6j615mwlzi1pa0nutjuqohpnuiui075og1pgaiilghabhgkmozxhq7ann4lcoq91bxuktpsee/i0ek9sqdou4xdjjyjncfg6a7nefmq/if5n/9h/3kuudlrsfraag/cshfusel07stlbt523njr3pzddzpqpv4riovpq593dsxq+nzxua1ohhnfzr75dl/add//b96lsj930yjdsuqmcrbyh6n6ux3sauqvtjs3ndz34n76mszioxm2ojmrmccjtwabo1wg3p3rrjxhurogzskcrs0keeeelgyzcpxaann4z3r9wg3afnuyhl0umypunjbjl0lrxfwvs7wrvzjb4y8jax7gwsjqzmspxyszxzky1nnt57rqyhglrbl7amkjzmzbi9z7nl0vb+oj4ps6ar08b/xzpdviwcvjtbtvh+jozd3apycwwvlmohxrzffptvv1kucpdthzwhprjwkbe2jbokuupz4w3z+xkcpxdzskydxg+pscew1h5rtif1icjtpztf2n3k6xxzhmfpleiwzm7mzmxjanbxhtzrvanbplk9fjyljz93y5/p3pdedepfyqdom0m3l5y2/pdexcdi5wdh9ey5pkqesks9omsguw29uepv2snb3y2drmtdzua7xvhunwpb4bnxtzpjewwha2qt4knfvc8zm+rdvn1g4lcvojsl5z9y7vgqwoxymjlhtatczxzqtz0+srch2hhjcf+0jcluranxsdoxdg9i6nv6zdwuqog1nz8pkw0+ch/j3/wak/wdsoup4ylgx7xmc0b2zuyebjuaez4ryskvtkzbbpno2qejctoq6p6y3pvlz29anblkevnka8st+74kiraottzcinm73eenj58ivakhl7si9i/r7tctp0v2kdtkuaqb9gpa9ep857foamftq8vdwpdhjtp75xjh+iyqvw4aggi4o4ksaq6hafj3wwnjhhxkrveeds7gydll3w7m7xptotbihatdctmphoa+dh3h7l0bblgogdgsm+lrb23k6aqsk+satnmkw/yd50l0mvknlrn64rzz5xx/u+vn4rudelmh/ac3/ahk7dgfu/wbwjmn/zhbfubgb9bvucqeygzqpibupsc/xhrp0unjakvn/ajhh/rxwhw09wyoki7kmmex4ce8qrsb5ge5sn0pyznuukbiynsubo15a218urwv8qp0isrt4xpumu5iver1at3g7klmpc7bf9t5l/ebx/wawl/7fvxxprthc1psztmhde51qxta61y3s2c/wknyjtk0jtlqtlpuov1byi6mojlbjpygppwwuaopygwwulc2od3nba4b2bxf4hcj/ahm1/wdmjf8at+9ftsiq2kakttydp6/vs6koxgmt+c9znno8woapd6igwixpllewtfbysaafgvsegmsfhi6kmdblphfk76n+y6kzkk49gz7rltfcua9rpi+rr84ekvwyjghhpj8znep1qle4d0lu3ul5ew9kvc0tq+nnghmrgdfi1tr2vdp+v3rm/wc86u/mev8a2/evogu4mpor3pg51rhjo8t4echwm8vy1i7nreyytoge53ebpjv/7ldeerdgxr9mzwfbuullhhotwylj00ohijc10c0cj2zu6bqk3te+nreexaiejrgwuacdoqveed/tv8vyev0nrbro01bb/mee9v6lo8uzxdwlt5wu375izxyg5pjjoyfqdv7+axkfc55mwztsolnxanvbxuoe5b/greoyq4wbzzvybr/aqje9goti5wwh7opkdb0t076hqqro1mpw49blfh9cnohyvondszd/ajb/allympnsov0b2u+gwuzezhjftuodynqhsa1r2ruc15a3q23xejzs9xe45no1c87k+kzbposa2xkwyon6r/paq2quadfan5vb8jr4pa8ojmza0tt3tde+4ck2poqa+cly2f8z6to17229qhuw5/qlyazia+afkkbjxrtmal2ttdw/s3c26vs6btvs8x8x+jwtt6v3eeq/2nvscsyawye2er795tf/adcx/t+9w6rhesiy576kvrw6udbnydbbd/whg43u9hnlyulzkbm5vasrf2lepaccclg6ehyjxxny6dgmsns9hh6y16knuirzj2vnz3pk3kfop/sp+5mh/k3/anh/3lo3e9a2crnjylmbdmt6ai9lqvrq6bbyipkut/d+hy9x/sr1knnwdknlbcs/5ijbsglfg6qlbrgbs9bh17dw3ikmvmbg9/cf6x2a4jfkblqil7ahp4bi2etlf3tflkbxgbovgnslsqryjrce1wzdohxoqhntaxt54+rkupsi4sl2pf0yrbqrms5wm93jfk+libkp8m/+w/7kyh+tf/yf9ymckh/v2h/il+h6gp/2mdr/2vp5s/5ih5d/acb/aow/7l7kp8m/+w/7llwip9xah+kx4foh/az1h/zu/ll/aji1tczga6enf/oyuoi30slb51kwqtl5herknciiaciiajwiivjz2uiiial0c+nvafeppgdmjwvdw5zmtcpv0niqeeuitwtpo4qkepn5fa6uow9n1j9jihpgx6soqtstfagj+tknnp5vd11jt5kwcpsbgyfjdgtaapvkgnfefup6utn3g97pi5ndwl21+oupvwzxh7gi/ebb3dvq9rt3bpu0tko6tuhxi55y2idvqhrudxq0+sptw4hqbiatsvrgx3zr0wsdo+a3groiyvlpjeltzwsv1rbluefh0tgxhrbkag+qfuwvw3gi5aglwb5x+5burka2ic0+wisqynqrcpol5wzdbizjbac9gglm2i25ln2nu5knzm9s2hcsxhxkosnfvtju81fq4gojcnw7dqfajalet2lvhssywsmzjuvei4gc5ere3lzk3tntinoynm8+p5kql4txdtrtgf7/amtib+v0ymvvgdyo11lvbcwldca5kjqqbeowrevqaiigdm/pobmmiozw3pvxmip7yn6e6d2rp3pntdo5lov4llvrdjmuhkxc37nfwuukrxuys2ijbqgoomv4yt8oq65huie0x2k5pgjzjc192xmottnaebaun4zjldas+4l6yz2nymlozhuz02bnip5coqhdrmgrbi4ajacpkrwt37mehl77hvlztgmq25dqpela+oxevvkjbkvbtxc/ijxpc9wrv3k94mdh0rgydugqjtuqnri5zc+vxougoadlxc3mpzh8tnzjyea2nrklsvghqys27s/i/wacezhtvqqco4l7swkpuufyq6fgsazobi2xtwoa1r4ydhc7shxtrqbg6esfzy5hfxy2wjv6vmvpaopoyy4al2ununnci9i8izsenchzt5xv+lcsluuzfopqh4uprwmeqzdk09dsqhetdw5dzxhl9i9k0jkkzdzqronmr7ysxiug+jv0utf5s/6ijt48efsuu9zl4zx19huxtmjbzwbjb6boq+oh4c2eoovrg7tgbzzrazwrs4ddv8tfjww/g3/pehvuc+gpq3xm2anne935wmhczexfdfqjra9j7elscksmslww/vmv5n2bzypp7lz/anihfhihzru7z9apd6r+xdu48j7cb9sbynfpt0h018vynxonlfi43lzoojeqavsla+vvwau7r+hlcmf2jsxoa7nh1j16q/lruuluasds649y2fdqejndrbbxadfxiwrhhrneawc9xs2ongliejqrxizuy6tnuaqoggukl1ybbwblfkyyqgmlcxahnkxzqfyqpt+8+pagt/c2pznqamecsffdewb0kscfnbvzynvs58lgz8v5ua+psziveqve1fp47hiqagcqtkyl7f4jpshjblc+hpp3bsuels4fnyw5r5jl7v3ndfrtqrwziwoi/lhknpm0akyuddhcwmhhzewbmjagj3jmhg2qs++8e44lh3oiq5mpqjy6vh9zjt2ktuga0hvxlqvdzfvvmbr/ajcv8yj3shag3ilh2r6ox3h6amf56ukedk9wzeqanvwbiqjlzuvfxrulq6lsu0qah8zzhmbsxtj5wyofquo04tq5idh3nnw0vqpk1t4k9tcwvvfw/wbqwal2t1dj5zbs4ywtelpef+r/ax0d6k8ze9mxrjd0r7j3s2pusvnqfdt30ty72vs+aut2wzmvzeoxmobioyz8jropespufsuzgbpomgwqp5ezd32kl3jouafwyyynhlmo5r4jus1b4jxckbljiflzb9jqc7kqerxjas3tp7pji55c9xajs21i86aeavv90omembowo27muhe8afnfiobxknfnp6o0b8pfab5gyazjvkzyoqcl0bqac59rzyee6llsawc7hhtjd8l99zzvmxe3zxb/sxyvmhxs3x/tbd2q5axpubadt3blfnng+k/kqyzzddkx5jrutjqqo7zn1fcrzavnkydmx8t1u+fq0xylt9hi1vefgrwqbhqvdw8zjwnaxfz5hbntu0vyy9pl3vjvkmoeaz0owpiwljwlhzjf5348fu2g67klyso4nwow2kwpq5x2vqkv7nw2hx7vmgelb+uaolru3vx3t4lvrqoqcmyzfs6fit0wjk3/aavhbja2la/vkadvpafnpbswhylgfyu4h7clyqpfca9hx5satkjuwwsa2/i83/vcn1xiccb2xytnasawscdbw3axayqtsz38aepji28vk2v52ibryefny9fypdbotolfumgmsxvzibn0lhy+3w3vxyn5c0oeh5xzu0sgu8ibuozntboclpluyly1wrm4zpa1sxkilimypczsnftzbf2rsco1wluujy5ojzqdxstcpmyt64dz5rsetgvfjufaq4q0bbwmvuwilwnlc4h6ucogu1dw5c1i/wb+65nebgltvpbia6mqgn6onvxd4dorz5jlj+q0/mbexy0/yzm9ohwntxb4fsxs/rrvxy+mm5y0e4wflzkygmaebd/epf6ppf8asdd6zcljbtaqbiqk0thvurfgl0iiiax66dri3l+xgx2kbjy39ijqxadn8hjcdr9fis3iee4zgd6vecpejqe4ffregqcshidod2e7fvqlcjasp2sai5e79xkw/uy1b6ds+o3vxjip3srxjsrgunwfgpwwv5vjmxhe2vwc3ni4gi8dxyi19y2jfx3w28toqxis3pdir+kwzszb9z/ib28ffmejyxzfnpib8vvqxrluvcn8wcj+mpus9ztggn4cllbwdargpt/6kv5xvvbzqes/hsembbk36lqpgqzyakgdqbd4qcr1tw54dap4zo8dyxugmw0pizve+30ispoy7sm8rzhk1a00noclv5f+qxelvrsjmebtszuc43ltuau8ovrw9bqlnrnz6rqfkugqcs8sjlkkwmhht7lsdvuztsrjzyfwi0cljjewihd4n3ljkdylduhj6aphu7xpj233k1jjylyr3l2j7lajazhmyzv0jgxo8svhkwfllqntcmki3scoy184ylthibmmmgwb+a083g1h+xssct1vmyytw5jaojlidg54emuizcrfnxxq8iwoongbe1uwu93n7+biea1mmcpxva9r4ri1wsr6vvpnc1cv1uq5a2pqlc08giozxi0vcwnwve59n+ta91p6r2mr/un5c10qi3ak4/w3wg+ktyymzybu7tuk73aj58116aqrgdoq7wm2uc3npzpn2f8bvakpvpezyco1id2bjbt4wxnb4v6lfulthk0pilbi07oaqqnx3wurstxjddlaqrckpwvieswkhlc3blc4n6six2jtl2nwuy1a00oyddvrt70n1zfuoqcm3txp3p1pj9ynt/ucxt9bhskyas4bsrfkfsxfk8wwfax0hh6gxfidwt/hnduxqf8a0nbf6h/afp2x86p77gd1f+kn8pqilovf6uioeciiaciiaciiaciiaciiacu087o3ska4tcxwchn0o6tikaysmvnp5rmswy4p2csdg2do7osjke1ri0a9ozqnvg4bwljnjhkkzlcx5zpoyqgw9zpvz6komcqqqscnnc4psknnozmdnqm5irla4jw2a+58dvrrrnqptwey4/f0na2ltu7ikqx9z8tpnhs9vck3714gdixlkzsg4vljccxihdlvplarvr5tyoc9j3xfxbynswgcwbyuyry8bipf5umdtoxotwjrwdl/enbhymz07xyi/ezq5zrbv3iowvomhrou9h9li97w6smvn8rcmod1akvw1/pwkvzme/6jrlqt8lzx6hl2ov9jlk49gj6oxi5we1wvhipnnvzhirba5asamtuedbxknnwmsngw1yugrga5xwlmalmzgqcrjsscfvgpjrmmzlxkwininq4cj1bxqogcym7c1/rxwbp0hb1vgucgripax8tg+n5y4cxz8coar16kqrx3llrcujppbujri9uth41j7mf0tu0ghy31t4hyodxu3kbuzs3ifwy+zkzfs9tynz7bq/xevui583i6oztcszjm70yapvvsdupvq8rwtpymc652zcwj6dxrohohiuryluee/mbderqloiiiakhzlgg7hqqtearqhgqlaxetc+5jdxo0guyiff5izkyggnrbczvzno8tsfcuhyritkej8jzbko6obncgauovnqxve9x70ji4+07lssloctcnsjb6o6vgcpwstf0lb3lgkcq3uwo4rxijmks+x4jxkeegxbza+n914ifjjattzpeiy42rpqemiehz1ja1wvoyw7xd0oi5vlewuc1wswolxdxb/yr2h1zojwsstmybi+22xvfxuule+r5u6rxc4jqxv0vahq8jtlj8y/d3f2mkll7y29mp+uswqng+pxizclp45zbhloywu0blyoahdhecsteflloexn6v3nhikl/kda/mdgmwgu6tlvfxot7q+kb7kute1r522zfvytt671tged9lutunu0ojnzngefve4f7sm8nkjynr9jnledmetywopmepvvgmadv6jb43t80/3ua86le2xjq2z6rxk0v20w62sfni+wr2z7zdx29ghik3ewoibcgjdzjyhh1xgjn7azjsa25ueg6qeuhb0cnlpnwmxdhcbl80q8ortlyq1ouopfbjfk3tqtzjtdt23wrvbntfm9op3smfgwtjbdzm2gjm9d4r3isily+j8rchligvhtdrroa7x0wpexbfi5wbo/ziadavmyvjmls5r5hazwhjwnvlgm4hk6tw5eiplj8rffg6dhloro3l+/1nciirjsciiaciiac8uvuqareqareqboerf5oeyhwausjhyzjzwxmbu958ngoz02c0xengenic0eszed2ebdxees5hjgptvty+wun6lpmnhrres0rtp863rs2j9srwuvdao7jxxn6qntzoazpiiojpdpjiph6i8pep3wxp22dwoa7mawaakfwu+4nvjwxby+wklpo745dhs7g8dpsvadaqdft+vaoo+ryxs0yxoy0lgylmm7ieosfpcnvewdsqoix2hgscnnjrb+xvcopaqwhqchagxvs9nh1hvd3xsga0rzwscalngegzuosfmukhve/c7ktmzpdj2dup5oh0hfal1b07ulqjv++peynt72pyvvdqbfl/ks7bayoefkjhbzxabcva9fxuwxbc4ngfenthsxaq7khwlpnxsfedd4rreg8sqvba+otx50z0e09cfwl5zzt5b8hf29xgssxmopog3uo7byi4ktnxweluitmohud7sr+k1fmkh2341wggj38wqsjs7f101jbm5/fhondche6c258fd+mmveywezq+qkdjrlfte9znzb3ryx9s8uccwtgmbw/9vr/g8jknhfsygqmjf8ndcq7o22rz2j6jubrusqanll7gbet04er3int1dgs0m5vmat9lmpg66hwjxq05aaokscp9glf8yxu8oxuxk5izqdnm33672xrzli456j9lmfpv6easnevh7dkpzchlh02ihfo94nnveyph5pywizj6zo9tettbfyu1axmvqtptcgakjqudspexhcbu9rexecb7fjvgjqxsmklrgxg+c5w67ac01u5pslqry/0izhtnbx1ftpcy59w6hvkpjxpi4nqphtbyoay3tci25hjrass9vbddbxcyjmz6ryzmwooypasp9ozkb6a8zbmdqu8ucmek4oobcl59qgwdm3ytgc+z1+0lqnbupcsmnltctipg37ft6jtbsmjq6bpmdjvv13zsb2kmvlszytbqcrq7r4yzgtttz9k4djkizozlerxwsqsgvpg1utmu9tsyhebjxc1vb9rv0ehibvl9k43p4zdni37zapm73vw2oxksyls9t2ikzey4w6mudjghv5wcpbbmo8mtjzuztnkfjvft3bdan4qkyojw+b1m2o9repgorv1e2izbptxubwzzmqqxhr3tgzno35qepbqxyjtnnp1oy9utefuoexanyblxipsfp6gjuxouun4xwmjaylambr7lwzibevle7rhut7rfpqorom5vc9krxlvqpnllmtz63vt3abwpwvvfrbrigxr6ncc3m2+pb2nwt8hsxs0x+jg1zvcafqug6psdtc57q5gea8oaiyk7kc19h4m5hhilgmacxpgvrqnt7puvq9jzw08hzbr+j+vl1zhm58zr2fweqprwvwvi1dvq1dmmtkdlkb2kheijs5vre32luc1zgwevmywdcve1qj1f6qsoi0+wid/kgma6z58aanepgxju5p5kw9owpgggjp26orx5xds4iau4fcy5f6oedp3uqnxummucexbsytaho9azwax0vz2vky6rxbh8+lpjmfhsvhde0shfifqizxgn1hhfqakrg+hqcl7y02gudx25b2j4k0pfla0guntcp2cik8socmntp6nslaxrp3oy7kac9zpmztn3g+q2mgcluvm4ogoiyndarolndyj2uzfxvxw72dr0o5zvvszi3xlr3nexameqqz3z/wb28sudo8nox/jx4nj1d5lmg6olhfhg6q99gstyddzjye9agv41w+d+exkahbkx4kdfoq29laanazjruuukv1tn19zhrshjkvclezv0lonjmfoxf/hjdifynfphuokbjvx7v3++5mzx/wbvduh4zu1zv5zztt04/slcovimnvkzjhpjsubnx+5udrurkn9b7h6vvc0wk8bupuhnrmu5htw8uthtt8lbofaopivpcqi0xxpioievprmbclw2l/wd70pe6yk+c+79/msiwip6d+d8ufm/f5vjmpra06bso2ege0rxyrxftoabdv4mrsj3cioh0davmpgmxk5q/egssczyds5xn/mlumq3upty+tluojco3ssikezn1exywsa+pk7tpc3k0enrjg8gq+noghyfjfdji10romyybt7mutzl+drkweimukvs6pq6qglsy7xczwblr7jr1wj9kgpq1da+sgqpy1uqsnv3jfu/frodxjoqsjsibkx0vqod8t2vy4tfg4oa4cjfdvtksqqjhcnmj3j/ahhe+cpsvfunyyqiocaobsgunt2ldbmzhmaba8x1b8dyxyjfdpbbt0oo1810/gviyo7szmjlfvza+/qs+tq8p1o8ereotc3jhneokiwghigwj/f1xv2y0upddrcns2y0lbxhiwgohf+zb+xyheftjkw5nbky1lgk3dps4qkvzdttypvkblirzr0iekmujpaz2rhlkm+i3o3xxnixobbbftjtfzl1fq/88ho9qtcphzlqvukahdyqvptyx2knvahmtyb3vo62vc4oe02vm3hsufdlvuhy82d3jvnxbaoqrfe0p3u1glj+wkucrg2gvzmdruvhu03whje4m1ua69eqtjketb9zlfvib2fx1d4dqfjrvaylrfnbnxmdezve4dxefrietwgn4qro8ans+zg13et7aso71scm5z9modetfccikse3pjmvrhvzzqpp3exhap0xn/mfojoi3e4agu0vr/o5hmcrgwbpprnjbf1x3hpe+wryxk2a6qqv8naa+0nx0kcldw0ncaten9lzh3amxwdvsnhgjd1gzpaslf/woyba+owupr3qnfkvj1fpo2zmzaqpk+ijtaottj714awyaioqnhjm99lry+hvyhkkqhucw5t2bnmaw39u9d1nu0ndywa5mn79/wb/m2vhilza2sn2zrhq4xvddvetv4jbe1odggna3klwt0c0ve2omhjdzwfh9mypsm0uryxzlzej4jp5asmcm6vpedsa3qtyxia2n7ov8bxb/zvlri3ugx5hmuicp8e0wqals7uzawwin1i7s+zugutqozmqhujdcl7jia1u+4cmoaozyh1ftu4fgxpjie8pl/0pr6pzaoi16ge6yivtzrnx1utbyb3uh4iqmipyc6xojb/szbkeus02vi4ujtkl1ygj4o2anjazcdmrs3t9i8liuafstlrtwws17inqhrqpcm5wqmrzegmr1s3qt1u7wc0lpxw0ulziczm0tid7ddr/fsbdusezmjwkbrdulcyvrwvr5+listl5dzevou0lszbvmvb2xmzfdwantjjgtznas55af8vxmtaaikqlihjli7nzlq3u2d015lx8q4djnjgqtzgfhy0hl3lzuvc0godcpfswghb6hdk05zhjy5wmoukq+p6udtsg/pkyejeykxuua2bud1bcs30vloqceah9wdrrceykgjihe3ly42y3es64+ivskdfh04sglzrvd08wfcso86vjevt+k/q6jpnpfccvbrvhll9f1jvngpcolxru3ci2+bvhwutjxwn8t5wu0dbkhcg2xchsejkc6r3m3cd0i2ep1h7v1f9jb1qhgiu+7/l9fgu4zraeoi1auvtq3uptxwhmrh0c6rlbwfwo5yywq3vhk7lsrbylgj7mjuhkvy22cftyvxgyatdsfqdyw3uv6vywpxprlnojbmetpwsa6viv8xr32/ota/xkj9rnyelbd0e1ober/qvspafqvqmmllhkbvs6dlxj5jnevlqdbk203wa5zpnczfyfm8z5br/eat0jxehzwdwq3sxfmbsfbalnzgoibbpyxmrm5ywzuzw0r1dzppkmmggak0nfbm7gqxfoeni+5ckva39wxh0tfh00zz2pbaovzo3dyksnloev4yedtotvumiukhy410m0ikbfjrpa5jisdj9hbcqycl18fvh29bi2gqfw1ibzm3i3ltuftqzh2osn8msfarsczm6gkx2pw1tfgoubfkdrfuujety2lr6cajtat888/wd0nptjk2yry5c7e7o8r7vpu3jiw5zijud18vjyk+0ch6nj+c8hgcixkwuiyub96pxt+ccppakvowvuei4kkfoxhujdpoz8371gqqqxfug/vwx46afbm0g4b5futa25pkfpuv6iktz/adgsoih5nnujtzuu34v/akqwb+i/whcsifheomuwxbcxp/0rbv6i/qhafl/oiyvv/wckn8pqiliilojhaiigaiigaiigaiigaiigcpjbkc4fzbmdhruue2xiudb5w281siqcukiuc1rrcvcggejk7zw/grkwfsbrqe9i82uxw1xg8kid54gl5jdpgjtg7t13b5lvebbac97admdzpuvk9tm/vidl6p0o+vua34k0rfkntberaep40ws1la2njc8pe7r5tcfybtzk5xv4bntkcaf8v9i71t5o2xdhmbtca21vitoipmhsstzgg3yufxdxbe9djawsr8thvukxujoonix4hd2uv4oxsmt4epnsciwdhju2qxtfo4cwue4lhctm8mmaa5wznltdpf97rspxekv3efiw7ixrw28+pncflxk4hlfa5xq5steuzgqhl0fwq5vapmcrmvhy9zkxmvwznwoui7mw+4rhz1ipknhd7ftuczk/r174xtkye83lyi5tkzui5qarnrqqfsmpcjnyrospda0trryt0d2g26hosxyjwhhnwrkplkciiquldxlegqrvlebnanuzpjowyuw8b4q6somvygq6zerfzcvpb0ffnp7fo+uvs9lx34xvnxjgny1l80ju6d+tihqshlzk1tnlxz1yc666ceffyrxveu5tyk8thzrqheuqru5ciiuuiiial0h9vl0xiia6rwnvsq4htzb3aq/lkeunvtzylh9rsonxzdi2pkzi7hygxllzjk93k+nwwbhwkpppwss3adwnyt5tprtxipgo6umy6njekrnn7whlnkawxuhdpdzrhkjw1jeq/wadcvwf1a6jpe4//wblt7zzcdyztggkdjazcpzi4m/ev05lb8u1ziawdz2tchnyinxy5yeqxlmj4kqktoii0nc4udg5ugd4dkr2o8uyvccuckbqyzml2377rfr5brss6kq2pvkywafvkmlv04resy42b4yemwycnrn00+rrj2wfg1mu7nad6xwhtojbqhgihoitex18wn9he212w+xbgy54oye9rsygosbzpvbibz0ajunu0wzqtlcd6zyscleqw81bpa5juxjl1/chjkdwmc+0yyeh53wumzghxsbd7g4bw01u3da98zg400ob5vtk3oey2ypjclix7z25hu1zl8s3pospxwpinflgaaodiqcxqtaoltdtm+cm1lipsy5ryvy9pjb2dg4xgm8p2937nl9tlawxvsx4appqxra07+wt1cehauenbkksgmxwey9mvibdt9xfcj9k8p1ftt7yk66bwt2ljzt4anwizqujaewruermszszlzb8wzrzyksxkmsoozg4pdciicnciiaciiajwoxxpxy6egcndauj8pmn49pvb+d48vm6bnibhrsxg2ssmktdnpzyogxijpc9xjcxfxjljutfe64lpdgp/wawotuy8z1a6umeph4mpqjhekujjjuxg5jn9yeasf6zz3clhsuh0fat1rbrrs6rws1id1xhf+a8cdezi5i6dwb6qxubme7tpqth8rt7min/agsy5eixt8tw9rwmqkeut0kwdoqhmoh5r183rykakx8f8ez4a5wa35rsy/xjd5pucobmfrcp7e5lrlqxxxmu7yzhcrw9n2f6k14g4djrgg3djwjutdfb3vc2khno5sdmieoeuv46g813wmp6eth+vydijyt5aq/w8dubc38e1alemliqgfkseycjs9p6g8lpvkng8hqjz++tjt7uvyt0vft2/vebh4mfi3i46ntx7dzw04dgmkjwwu57rbvtwoxrgyac7ogzohrdvrs/sap76kef5mofxos1uuicbw7+v+0coqstzcpfdn8d2j/vy7ww6rgvhk3/ah3jy3hsrsblaja1vbe3loraglbovplvcpdv7v42ic+io+f5evjn/eoky96prnnlozxc+tv0tgdjfncxxm8e4flo5mkgfnjpfi3vrhfkewy+ocsw4pcc3syhvfnbcdu1glzgx5ix7daxi3i57kzsuprau+ccpqjnzhyrf0u8psaw1bwtjkcihc5wsvygjnf7f0ss4bpahxbooxtmozwptup4vkzngmg/e2uy+h+kymyrdhlsuz9x7zfiowo0uqdwbnnsv06kssrdsvcboguu0eknefe7g+1rhicua7qbpp9a6zxrhrnrpd2y7lntppq/sxoomgaohc31zwb1uxkpld+shlmkdnksdib+stvpup4ssipjsqov41vmaej27/etjmx5rjhjnczo4aijuydm1jwlf2g3y8gnlawqesjfh2jhmd3eqbg2629owrwrgjqz2aktlqcwnvp8coa8xpfjah5llfmeefk3qdkllfswgnhocj6kd74yrmymdz17i1tf5lg7qxcrjywnng5hs5huuv8icwmnkyxxlnnjw6glu2h10fqwoa9rg7uwi6bljlb0zhqurnprx+jftthjspllq8cotnfanmr9dnb2trmte2vgcb28l81j6mkhycrlb6usuvcfcbtb/o9o4oldhsd1qfdqhudv6esvrtamvg1vewngwssfr9mpkkcl7hvdjhnylng11pmstxw1i4gqwyyguy45zdnoy3vce5df/ctbho+ub7a3uyphmglrf83n4havkmqa0o524rupluzmvftfohlmfjpig8ggi4uqha872wuadspbxljudtk3swbkultgwi9nc+7rybolkkwx3j5kquyi5tmxk7bwxvtvvm2m12jvejmqo6fjghrlxgackabnmuprxkx9y3mgyrjfg+mvmkbhozojy8tata1yoaer1tom6/lgdozwwjp2kh+exbextsdxmtfquqdxlsqxdcuji5glcajktvitpv71ycxfgdxppu3pxwo7fejpf9ykszqxipij0yo4zpa68eenqxneqxkwspkp9x1r7fy/ftg4/lmdw9x5oiy+ajychlmjsskpzrestoqxnd7inawkqnv8vb0x3g0ztegkmpcnpi2b8tunapji9llravjerfftmwqdfccvzfdbzqivj5k+9enicdmk+wpnafzn/emb6sxrobvmkl/tc+q+8ly4xkdrsf1d3razh8h+zbxngq/kqhrtnb4fss6uhg0e7ye1gkyo5ho8pqusqmc87e+9xnmadp3vznad2bzab6ui/ngvvv5pe+espxgvurajodu4geczqalvtobz5pffcho06/8atshd6lut0guuv2rspulsxrck0iylyzvfigfm7a5jy8qtrvra6dqbftuyqygaqow/qejkj9bhzujd9vvt6sluwlkjhpi/k21je4p4skbtqr8sxdbwfqfiyg0sjmwcadvx4ly4rxzjasdyb5dx4haydll1fr9h9qzcpp7ybpflzdr2mvgvduxqvjyon600d34bxytxs0jiagyjftdbnf2gqsh80/uopwjpfy6lr8ubql7qu8roipztv3bdzi/asbxskzvqffr8z1ts0rz+e53x2wo/s6z8tozfm+n2hblt53we6ztb2pmfb8mauzfvnses00qbckmd45grsl5bqwt1o+9lr+b+g2v1uypzcxjw5y5vm39uhkuwyfw5t0mjhdhyscxcss4hh237npulljxy/aaemtwn8yendpgadpe5hp0h49ueantdv1evgjorpf87mtgbxo496i/ehb7mhfeezens0eqtbotw39iov+dhhtxbkxho5poamsrye34kbqlxve3uafutvvzjw2p+alm3mvfr45gzg4gefn1bpgfq7kkmt3nau8g9pbov7+nuhik+estp/t6lkeay44koyjabbizi7ne9xb3lvvo345zwu4bkmk0nopl+q6w0c08tlw+f4dnn3y2c7b1r6j2cwu29hlpyvoh07jyixovpavldjoyq17hbpa+iakyt94wgrmeyl5tcdfta5raw+gawi4vp4rndgjxbc3iqcq85cikjtpxe7njw8spswxsjj5rmxg2istati7vo7rwch4+k7d+48ubsq25+kvwn0osazboog1p3j1cldvjkk6kfck4oglgx8vv8idye9b29g2+jwhjoptyh2la0fryc27exs5ba1rzrl0xhlqofd2v41vdoxryncnhnchbw89cergws7kdj9hvemmmuvq9pjjnkhs5o70nestqaoz8ra5znwxgbooo5knttkudr3a7fzvufy51c8ab2h6lo+bo7sbho9la6xbrpyk13oc9i6rciz4rdroraog41uvbejajg77pb9qzowzgwnvyrimtrjy7twy13ovjpbsus+2mluouwfqrxswuhzdjufmwpa6xgh6kt8nr21b3hrkkqurh4yzccaqfytvgebsq5dg+bsq1pdmfsxn9hfpfvaimfu2ov5xudbn5+66jxbjhbmbsqkfrsksrynbpq9m+pa2to3oyrtvkfz3r/aawbfbzghgrmll26b/2loprjtpqc2h3vzko9+3hsxzfo6aki3nxcq8kkkyzzksvcvuctpqpizgksyov2qrelcm5lufkssvwbnisiv61ttiopm0kmdbrpr6chv9yzvrvpbfibn1o5g/alsvbtd4rp9hjb4ps/8y/llwtevmgvydr0ygnd9p1ixa3vlxg0plazpict7lobspmklcu1e+g8cztlgrzhfbo5wmrobutmjc69p6sbtbn3torzgq3gh+koimdo6tho5w5u0zk05ljo7x5arlpuyucydvwq1idsxaxvrskoiy4zmov+ispefrgzypnzyd72+1ylzw0ra2smxsnicwh4jfia1zsnbblsspb8uzzvjdqxndnbjg9v6qi5jlsphtnecxolw/h3jw0aqh4hrwi6gwvm1tunymsfvqesiswkh3hxetaaf2ozfpyjxtv8vvk7ecrxoogal/bcj49rzj3l75cn8keu3iosrranphytwg4ruqheasysveds43jvvm3bxtb3rjpclz3c46bpdb2bxxkmd3c3ir+pytelxcmypcs9axc28orh4am/sxa8sp8a9jwx+h/wbctins3g3t8e1dsxmf8a0jbp6h//abhxbp8anxmjq/8arz+h1rgerf0rwgreqareqareqareqareqareqa/h7qv17gfgduuwdnxkhpzuppl81x/hjchug4nxf5putzpyxy/k5l7eb8nbkne0fepvhk3nppn14fdz4ezoziqwubainwdifuueo4ciiaciiapcuuceysywoyym5ha0tc8wsxe7dyu44wxj9psspjtmjdlnkduquna/e3j+1antqgx4j9xznxrztfui992zdzfddlh3vbzfqujzckuotnd1uhlea9xm6y4linqyc69zlhdl7mtcemsymyzlyzrzojaus6rwduxgkznuwsgzpogjkpcovwrhojpxir35+84n6pikulbugnvlg7cxulqjq8giios0fybjyncyrc4t7srawoho24k6yuc+kwd6ln9bpfufnzxlcwkyxmzpwoztw/ldietdulbhb8lfvtmja06kdpiabnbfulxej8obt1uktb3agubz5bfbbnir16o/jyh2efhen/dzg1ciiliqiigaiigaiigasqgxgwb+ekuxu2jftr0i5rfrjkkksmdgti8xegsoljkazxjt082fcujdt53g61z6qne5znuz2x17on+l/m7lwoolqhh7u3uj5xvwaxn596ybf0ep5mnjex6l2ybjddncxzuv7yg2zes8tpempqu8gde3msfschgyqfajmxg5rzyfnlp+d4jstnpdlidtjosngndpu7i0bnnu2gw2zhchxx57lnwbghurzkyjj32ytc+/d6kdmuqydwra2jjzihk7sw17n638lclztiqonls9kchysj7ozyi/56gpxmk7dpbculcrzxjw1b/rkgxt0hvffh2ebozcbve4bzntwt6rx4turvzi5xunhqmnytqpjdxgd14ystnd5nwub0tazi3ysg9gs25ul89lckuknj58pzpsw7ua8cen60zjpyxw9qkmultdricoy+wrja5jyc3cnvw1jlrbdostwrxhhjkxlg9lscqrqnwvfuxpjag52xjmkegixghcdkt2niiiuqiiiaignyhjusvkebx9zw8mjywklm3y6dm47nwcu1u2y3pqd1w/s8stfuxcfqcxmkkxhhhoqy+sy94/f1b0pivcpvjcjy8tpz0vvor4cqji7pjxklksu11rrrlw6jdmhg2wph6iimbuutq6j7dy31xc/qvbs4ebxysi9iehyhlbv2w2ronylovsyu/o+jf8fcibt5kv8w/ynwnkd1regr1amksdm1lh0v8auw6nlgmhy6kr9op2odo5dbqnppzswl1uepxyvhmnsxyupnriy6ezkjixpcwm11lw3sncv9rydubzwkhrwzdyi0pxvdqtedwuhpylptlsfcnjq7vjtm7bxdsrujuarjnkjf7fxlghytrfmcnntllni0uscv1v+pnjjivswr7f8izh+vybmiynrlvsco5xjhfaur8jrpbaam/ndw3wugxzewbgo7rgucb6dqcyo7srynjdpigue0pehbyc/wa0dna6qtqru0jqoqtw79pmmxgoehjklgdjflcndhwsqr71xtgai/zsj/gs5ophfqrtwhcpcnmdsidjmt3mijtmb9mbl+phvxiencjdbv1ezn+9ma+2w46gk3rhitbiq7wjee5hilpe6+oo7eexqfzqbsjb1tsfdqrdreegxhreyevut+pyr62zlvdgmg3vy00kojivtan5icf1sdtq5sxbq2ro7k7mebgoi+c1eiyrytapvunuxwyu1vp9xunwkmsfuhn0pz7errmenlshvd3+bcvcql93encm63xkdmf21hr+l0uei1p45qo3gokl5nys8igu1v1j9vby6qonsvayuuze79apeqaw1zyvd+q9yqenkhpk2dbsiuygvybkzch73ffutt46rgmj02o+iyclhc9xdwujdb1qsbeaw54hwswlztyoia2yfpaatkcpmk+qjukrrvvqb54q+pbqk5pezzssh5nvv4yefnsmb7qqtt/kv87mcutpjyjy3xcs4+5xnrlzqy7vbbbtxd573nowfxrg3lthzeqrzauneu+iya34qttgzm0u/sjktuqsqru3+/kwu0t82fn/ahh3kl0xp+1cf0gd4fzriwjano9n2q40i1etqryncixhen5vze8j2kkh8rhjjf0rc+9bgz9gsnjc4oyojvb3fntjci56ljh3v0cyx6a2wdw9wvwv7hsqsyiwcvasoybzujeqsw86dpnso+ca3hkrjsxkbgyuj3d3qpmhioo4hqtspf3iwwtxxg/ekbuaemzrduzrkpjgvznd1farvpiyki0y5bcmulof1v0v5tvraovpunkpq7mzhjxite3fnd48mxwornaupgllzjkjmhbuof3sy9xdate5p7n7jvidplompb4fm9juzagjpstc8xk2m7nnpesmx6j61wuauottlzkchlbll3jz+gs2ky4i4yqsn9l9oaonprbp57ohq35qmf+qg9qqttlusxeln0zgdbgkamxozncwsnksqt7os2fstlcyilg419v7favr3xvnecjmd2rziyyx6zo7drh6ixxszapass9tzw9rxl7/aim1andvvq/exxp0iyi9srpmuwgyt6w9b61z+ubhr+lr6j4qpgvjdca2yb+itqfwgojakc0dqosb7dlbsqmvp8ic8hxjdzrpacliqcgurzzm5cxw1cb7kqacmvlc43u5ug168gsdako8d2ze81jmrb+jyw3qq5oha5sgerb3g9dnj02vko9tblqwlji1ph+imlztsaoowemudrfuztz05lidigqghxhfg0xcho7twtcae0kxg1qa2z4njjibnedrdw+9ufgshiviqgliexzgzalrmhrovyit1lx2xlhy07psqljlrq5hy71ibj7fbrm1ry2r9++85ghoobltinzjk4pebam4hhdwphmdbaga/tv6ndtfjlgtnsk2jiwl3x39x1vzxt/r08gsdp3cxhpuxlsonnhs9vv+gy6fwbsobuzrapyprun3jsptk9zqtfcanlnnabqqioybzm5uqvtswne7mhgqomjcsbac5o2ll8z8w4h2873/adb2b/6xz/sziwsanzwlvq6lcdnfmf1/gwvy0hmtmfewmko92ylty3hl8wwxbqqwmxpzfuv35kwdvxljtg0frhkr1nt5tfpsrsmu4qazaqjhhuke3x6lals0a+nrexz7m5nnd0nj53wlxzdtcbqau2i6owzhq3obfwuh8o1qywm6bkcpiib4d7vlskfe3ib9s0bpz5ob6yloocwqv1uoaynsdhqtva8rnjliwomchodt2lbqqtn2n2k/dukaoasgpuhycjbhkefvhoaorta/jefptsvbfbbrxwkpxg35fmjbfn4o+xxc4b158kjb3nag19f/af71uiwnhc9skek02wsxpjfccqslbmtfwjffkx5akjymlktfmvmzfa+yprl9jghm5ayrdovnvbwrnduojs1ketxvr0/huw/9fugfe4z9cgr31brqrdy9q2/aonnpk+nlkown14zx/rdtnh2glkut0zpbhzlpmfqvthrh326eboh1ec1akwwgctdpsdo4ado0jxtmoak8dmuaiicclgi1ilbjqrnyngwsvlw1rw3bu/ahjbgn8m0z25rrmalwlnazj5nnsfawpby4htziw0xsmtgplmq0b2wpdvnbnneahr1g+qjjtnizgfj1uwanstfuyubsvf8fxxzi3ob1t/co0apic1a3l4hwptlnitjcjk0nkcdjo8mi5rtj3d9ywemkogluy5gymtk0rytasw27zy4bt1flxne65z53scr2yozctnmvucrfvis8x/k1mkni5nhbotsjaxufavkl5km8r4rt31rsza3vhvz3tsgxvoafbpo7xo9ggj7fqkwkiao5zjynwgtltizo0e0/tvqefeqvajqplmiixbnt3gfsxbsv/wbu4l/rf4aul07o63xx/au0yr/qnbf6l/afcs/58tj6v/rz+h1rf0rf0rwgphoiigaiigaiigaiigaiigaiigaiigcvci8tzqyxquezizhbmrxjlctu09pbdbxdoh4s9vtnva8rdfau6lc6jcmaix3r1/qqs50zktyk9giis83aikny1xptuxyemaqgzooret/sowt4qln4iskvwtclhvueeaz0k1mwcolnljmoutgp2rmk2vegnoq5nsluuwyxsvfk3x8dvql0nprdomovk4jqvyriu5x44qs6irodpwvar0pkos6tabovcrvcry916k0i62x+0c8c+9xdwurpf1s7twpxmmpys35jrg5ulw4dyrelmpo3rxcawg/cezpl/ohmlpy5y6pehvao86dcepbxl34+qrejvcved4o4mzrsslomed2ux+j3qlk2j4plupmkr8zrwhjohro5ka+k2nt6z2mfvno18nioa21xfuxfx4x2w7yuokmppbnh9zukkq7pn+qsbfqdp4xzg2kp3mygaxbzjaxjtqt1xi8aqu1qkis9w+r1vk9vsxwmvrww4e57blagajhs7baffcycj6fhmp1pgtdaqaadoiuyyvw38n/2rxvoetbwfumnj1vk01nuc8ereoberaberaberabb9ewxi7jw7w1bbexwid5htdnyps43ts3ofvubluvlrkv2fhk7k0nhllkm4l4zmsjpj6cijje6hgtzpvoqoyxu2saaafgnab06kqy9wfxryrs1m7gzs4wtprhfzfmfqszwggqbllzqb3jr67t1bw1rrrk4vkle4rnhtjzrhughmhhzc3vjg5ddz1j9643xbg8lnni10raxz3gj+7xnvyk7iqtrxbgrauf0tjln8zhi1w4bk1a3lpty+hyz/ubbxffrjs48focqxiv1vm+j743tlxsni0/x5kyuhttwucq04vd5pfh4+pmqphx7xnyd1dpqssdmloex/rmpxk5p5fwcbpqzncv4s2z6wi4zaltxma0nr7dortxoho7rcrg6mbtmy/nhmvyro075du8yciiuac0qbsoixn7lkqfilyrprkwls5vkkgpjfldmknn1vzvo6ekjy5bwbwo4wv0obr4umpcuobxrtzuksjqfk7x9q+j+ck8uoknzthginpkdyh4l53oqv0skcbdxspdb7tv9a+nsdwykonijgpiy1ot4dw/xvdqdtsj3l1mskt7egpnadmrx1pkswa2ggssho6n8espwexllkon1gv7igkdcryxaf/x7lpstralnbu53qt9u6bvmoxywhyasyayt125ghbxbylgey5rlqavr92gq/c2wcqk426uhvqau3ytqtnnjhtlhwba9vqyc+yerua4z4zc8umzpllhzzneuk6k8lbqmatdonw17vpsttysatswz5ymw8tvyi3b+skmanbkl27/ob9oc6jxnwmjgxr2a69xyhkvfjuezld/k3xassfmlrkhuadskk3hledtu8ig5bcxhjexn2ulxtcrbho0+jo5k00ly3a3uy3tuea0adztwvwu6lbxehywxmtsvbe/y9flojyabta+fisttvsp5imsg0gbmbtnfw9lui1t9yfjmecc3ubu0ntlw2utzjmidyqq9or/ecsxwhmmpgewjkba/grzic8ta3db6t1ns4xlzc962hf1posrbcm5jti0976k65ofrc9lbe0dywxgelprr53jtwribgyhhyi5gw9r+iv7l0bixdhuusrld5o7sp9ic9h56j2rk2fyx/fzwuu8ztaynbtvqv2+kxhs/ak5bqkltrxqwe/6gpcgui4sx7zwkk4aszgatsqmepk2q5fk+ixgrqaclokkugczui4scx2ljqqw1gktsfdsbqpkngrixj3aprirlldrukywnsftgyy8keglbzsjx13eng5iapo/7v9gckyyikecnosgsf/0ilk/ffp8aw9t56mmar60zfrv9i+l6flgfnx0syjh4m50ucujs+bsxgcchndgrytibbhqjmuu8ceiltc6ow8ny43mld6rxhrgfmnwxwglvxt6fadkwymtzjq5platsqiwmkidfi05xmec1wn9iftwoayb+nl2j0rcisqyvlbagz07csqb+vzb1hexjfp7qovtpvtdddz3mk+/dxk/fmvasxby7fb/vcoeen2q5knah5ac1osislzfiww4f9snd96xheutpss2rnl3q32azqls9w3bmp7g74tx40lthkyu0cxjmbtymzcrodyogxx6l0iyfkloqpk7xo6ocezt0zc1wqcbi5rst8vjuygvln5bhxubcvmcldddpp3cunnv+rjsujutlwdg4r43pi4xdnoyokec1kczvrbdx5bcazo7mxwu7ohkc/xzozalab+sv01qwh+rhctuqcdlbx5jlt0yffnn89+46tdzng7lr8burjg6cuza8xtbk2xa9vgsykqbo45ibodzpctkv5818+opznaiss7b29f9lcdwnjp4whtggdp0wbdw6pnjdzut7lzi21xg1m2g1uylxiinn1xs1cg9cea5jxlqkvcxayodmzmc95libhl7l9c4nlixaooctbjvoyjuxaxti52opczbpqphd6s/ep7oi+jvzhqwhiehrxmofwrzg3u2wo4zrrkjpnzrl9vvro6g211oyxgoguy5llkmvbqjz3adft2nkfcu+8hyoi2zjvzv1blmxbvpmny3vze5466uhw32rs2drzy2j3/es6tpvpboafdpbcs2skmot7v7brezv4+swkm75zvx5hffssxs1hzt2jjmjj/hc5bdigucsllrsapg2/wav2njl7i3pnidrl0b2dbiwpwxcql5zunue3h0vu1bcwgu4pkllsrjik2ykab11i9u2w6lutngcnjt4hovejlaouv42visk1n4rmtdztyqler+oa1bo9rvr843up4bwn5vmgkd1ovl5eauvreemvugihybft6zt29as38g08/fv3cxhlsy27nzhqtozhhfrqr4nuaadnf7j/dslidwl0v9hi92+bwppps03b0wpbvosslb7hl39vnzhuwgtynlutiwqn4fvxa1w8gkutsesrjydxscxg2dcr4kxy3liapdpmsf0l1avu4iztmsqruvblehefgapcqcvsvq5yqckueqxkvcc5y8jke0uyk61sy2e5wvno6yzromuqhlvtv3wdup3wqq32vao9jyt48gsrh626q3lbyeqtspubk+qxhkwdn5z0fkgmkrlogfsvx0laxsvbrn0em13bvg124uwj9ovu/utoiwot6xc4jzaxiyjo73/ai962ldgdz3vvxvadkhoc5sqsykdqw3jgrqxhtjgfzwdkldafvrxkwbdnupzr9p5lmpdui9m8u3cnefvrcc4kdnvob77xwnxg4z9huucshkzangxmbpyuabxcpqxoul+jzjfyexkoyclwmyglfrzadzdqlrnmksjljl15up1ke1im8szc5jb6tqk28svta11xl1jroubddb71sphpvk2fphzrqeyufadisphueg2+hnwl2b8nirki2hp1ilenuw6da0bvtxzcv/1tgv9f/gc4s42a3xxz8s/1rgn9d/gcswf8+jm9x/o5/d6ojkii6m4qiiiaiiiaiiialy69raberaberaberaeg4kpi+tgttheq+wlswxkprwb8rfpcie2d01xvgshqms1sew7houurbpm2eovcuuqbtgbjnqi6ed5fktg6z9rhlpzcjve5opopj897qycd4+zzxu7xfk4ndnb5z/2khrdsklpwy+5xnwrunatpjxhb4herabjheraberaberayciiawbrhtem09xe95sw3y93qebnw1xamubainwdqv89rsfbve6ajilhqy8wb6qhnzhuqxft4hs9aufvuh71+zi1znmaxrnocgta0lzjpyw3v0lc1484nbj/oslszwm80jtot9afas+hrdwelg5exubak5y+c82qutqdji95e52z5ic4lxtfzwerdnfjlcoaljyewzetdk9jy3tvdgz1ynojapilhrejjcbktlywiilgheraberaberaberad4+h2lupdts2slp3nonzgee3iigok4cun+jaqjp5yynipo6fpwyzupqztuvi3og1dndw819cbovlqnyhxzsrf7e0mrm6zyxce9m2yxou5teirj1vwttplm2l7ytiodhnpcp5xbj43wlzg1pnnn16nkpb2gubcxiubfw3wywpsntejlalg4pvlmnljcqohuzmcw9jcfpqd+nfywnrchc+9qhsv0gyg2wqaxrswhzlntg++ouuxr2aaoxych1ouzxu3hzciitfaiiiaiiia5rvbrfwbwdvyrwli9fxbq5ufve+1wy5my8tuvgq89wnkniosu9yqide4k8c1w72iubebxwoa9svdusqkpzi9jallzg1o8sdgmt4wrusvbofrlguay1dm3exdjh55gp9i7fqwfpvlv4fjdrzhxcmwrrxac7r3uv383e+1tcgidex63v9awattxauo2vhwqah8y+14g+h6k8jabqbrhs3yt5rdr6wrtjzx8/jgvbfpywmfx+onifli/iymxc77aozkghamlsv8tzwsxdxsnhgj5mjbryepe1xnup+lpk2dza+0elsrgc9no5vpxwxwfrzhzp6gbrhz0g7vw/s1apssqvvp4vrmxmtvhyjslmei8imjvq5ezlq965blliokkx37eare9wc5kivixtadorsre1k36iwvje/mrboyvlgtriiacywai2ts41xoq2mrnz5ef9l1njkimhzf3ezanxjq5xkn7+f7f1vsjovnertvwu3jrdjrdgaki68fcqrke1uevk/lxw37jl95ukcpcwtahazg4t6e3kr+nsutcahuht3lvimt1ot9b8/nx5627mpbe2x+9vp0/xuolqnt1hcriiutdxdcfevzq57tmxsdx+ximgqnyg6gm7tbezpjzeuhhgtm1orj9ghntnxzvyrps7cgtotwr8nncgcz96umcg7nsb13k2ufqh5iivm2pj4jlspojkwfpvldjxwrhrgll295g05jl9jpu6h0fum6hfde12gl3ei7pn+vi9dgphto08dyunv23uetz04jhhmunmzayq/syx3wufclhpbb/ptdtmicirv13tpztop2hfx0cv5+8ygqsfunv0k6z8jx7usxsmuqvsuvq6udfbhr3wwnuv7k5vqsseqweslguhnw0w6ojpu/avoiiggxbvr1fmrb29sm+8n9i75rjqllud63usn/p0cw2fnszaf64r0lhqjlao4rzitx1jdyksdxozcaoptsvmumi0djudh0/f10b0s492kkdk12g/ks+/qfc/ldoi3+h2+iurlv+rvvzpnqxytuot/cvy2w1o5xmvxavu48yjksydveeh3k44lyyja3flttiqqcobg4l2zm29vif64kkraiybh6k48ivdwgusp3pswhtnopmd3xyjkrsc74qyybc3/apzpny7tldpo4c7dbxhnhpjoykupj06aclgnjdc/viyzzwzvri18kdgb2c0ovve/nd9wca0br4l5ylni143dgfjuu34tjafpg8hv7agfpw3i8fzxwk3utnjpywmutp404mbbe5pd3ncwa3hj4lhtbuz3fxfr+qzoov1velctm0xgbm1mgd9j3mnqtbhdmuaddyf2qc2pkc1pkfct/wdxxkimekabkgfhzdmrsdbdbtulmpmrixz5jrlg5ffkaobtqayszoijbu5zrc6hyd2lspa2apqpfluzthhg0r0kl7zjebyhnu+ovmylnjfhm+w6klfns2vdpd2r7e73yi+yyslztdxjrewu4jgsstslqamos31r09vjvdmori9xvcjdxx/e5g1k7mzdddy00zog18atoiw8zf4kog21hftkneiwperx3dxniyoa8vckukzizctotfazvznkbe8lwxgqixyuaw2i5a9sd9rxdmy43grn1ehu1w+hqny6eumayywuhvwi+sz0sduuk4thvxbztvfjgq57w9rcudz3elxcxfn4q905vytuq8z4xsg1qvilc0kwxhi8vfvnbv6ck13hqa6efgq4g3zm2338lqyzftjl4j16oqor8hbgo88wzcmjm8ru+f4cygjrgjqbk7l3nxk576lkbscqfbvp1cfbsv1m1giznpljtl+rkssgih8syox7hslbhwxba6ifpo+mnlz2myhllv1x0pxtzaqenwccwoc6abshylsdr2vfmoalw5vgb8itew/j0dvvihnbg7nr9tdd8y0fa/dd9o1wdtkjqrplwaaandqna1oaab0tyuaxrbgdnylndrboen4+xbfh1onabg1jyos6v0mvcmqkxld/z7tvxowzgtczq2kzoytulosqrmol26thvxt8lbb7dukrwuvtzkzfusouvpzl46rwc9isxievkxpjfvi9y26a2wiqlcrlrkqsy2dqcon1h3evdpsmtexow8u9+xymbe5uaxcrusb71kmvei2w5lq0tusfh7vrujy2n/p0nwzsti4q49zuegolwob3y/5g3gux9ypsaxjuuquqjxfzmsnp1+p7ss6np0a005ljlwwdrahqsmao84208yvsci4dmmlsinbmwcryhyucprbbpwvbulpzsccwzn3joxo9bxtvdbeorqwancq3yoajc7wa37vdrcwzywta0nsd+cfhqqowajumxi1jslhpzz+ju8yoio2fxcwmlzzhkuoljiaouwni7zutfwss3sxadckaz04y0vo50jsbadlql4jgxagacm6/2irnnppgcg86dgnntsbkaut0vdi27r8gc78e9jdnoiu0wgeetgper3y5wswzoxl1wvdgl69bewdf4rg+cpjzlpmohwxufynsgau1c9y23l7/ani7nxn/aokyh/qj9ql59mk7119avn+psd/ob+ofzs/58tn6v/rz+h1rherf0rwgreqareqareqareqareqareqarejqb0j0a4zzk1qrbtdkzf6i5qfknccxltfddwn7uahix2w/qalsbxpe4na0xc87adsuauzovwxvo+6fbu7ac9mfmxsuc8ucqvvjm+fkzxmkbmy53ekze+l/qvffhg0kcozszruywamqap7x5aqb1vu+v7nypl3u1c92/l4k7z2bzrmljymjqnvi48oi3qt5xh+zalr6k3j1jpm9sv4ilyozciibaiigaiigaiigaiigatph3enrtsdhfnka83tyeg9wnktwibkezlelkftqtpvvb4fsm+bg6l4idvyub3axfycihqiuee5yn95t+8iijwwiiiaiiiaiiiaiiiaiiiaiiialeynxxpsmdhhkc1xzaphqu6haneydom1isyislvnslqg8mz58cqxlznvchlt7oihkbywaijywjhhctqsn95tnhuvwdi1zjmolc55kywufhzjpmkkioeyrrjuwjetvczos1qz9c3wdjfb2me0nnjheedtfysi4grtagoqecxay02lrjzodyvooy1jrsvxamljkbg67g2a3dvkr6e1nkukdlprczunkeh+s+jpnvlixe3lixopit+1eii3eshjt53ciqmrlxdqllxdwjqsdkmesmdvubteyejr8nqta6hkt9gehwvt7px0u8wasffr1bzaymma4enls4svpq2b0cg80xe5z3es9xc7zj6ktqqota7lh+zcu6myrjlprnbrhbbrevkpho6vunpufhosarpy3m1zobe8pvwa7tq7rgfmeiopsrbmksouwcyzmk05qy3kxiexovgmqrtmriivohqyq9fknxo8wf0svbewbf6p/otyunpav0j2sa27nodwthw6+gugmhbt08cyabgxcerrakrpva2iglcsv2vlvlw+f9sqyvs5bf3h7qt2jfgurldvv48fkpkt4+cyo7iuvhqkutzhyxp8a0i44ykawzrocozz4e8/ddtqv9gtlxb/spipkmjivoy7yppyfaqsjhxus+iyplrtcie4vsdtuqrb9rk1p9rtsvqcmagtaggaab5al569htpnxca2ui8zz7g6l6ca7qll9iqmakyesz8xlnh1g/nmqxqzjirzerd5fzirdust89vfyz6yx7zbdqvqfbeosdpgnplusyrlmnabg9xzvsnytyouqzipyzzxopcbgjwun9ibzfhufbgld3hpj+sadwr/pi6nop52zisvgxqju8f0xnnk/m02hv5lmnhsgn1jlnh5pnh7quyyrhpyxoy8kmbvlg7jbmopwcdvedi6amrv8mfwhgdzw10y7pwpefkwhzv8aqqvkwzjkzqcglkf207vjrtp960kmepa9rslf2zeftc6thvvwn7gwxznnrr32dg+ljzwfj3bzq2mexcgojgsgfg88wqrkeqolptuwk+6esktaxlujln7kujily5tm6zb7rcbsolmwgw0hhbdtx95krxateubf5t7e9sgq4tyidg1nzoclsc7mbbeqz9qhfbpoe64q37lq3xg5hsswbotybzrz8zywzjks1xgpao87l5bv1gbzqvikhcgalplscvnfkrfagpmwghny7htfxwjqut0voxat1gi+mm1hp1v6lxkseksdy8/afdjxc/rtzabn0t5wvbwfkzwszbbmq0nba++4cstznuthipf3xutjgqncwvleqtp3u7slhyjkp7tba6kwqokjzcxtgwg5zqs6+uvswwhpiunvkvi1hjcdjygsqsil6rovyto7qxzfioa0ke+kzgyu7uyc5t/c3nqjpxu9ilm0icf1solirfavuxk2hlxzlpoy8blboqpdykrzykjrnyqsxjlnrbc3wunaruysqnhl70bld4ojeiqlu+es30wa/h7v2unggxmprvb/o2e2kkjypig1/guqqtwtl1qsmdnrjooqj7pqxctbxdxikj7ybbrs4+wleyhdco9lmmzkyxg2dkrgplnb2apzi5trxcff43fy4vwyg6oqjpng/apnv0b6aksrfp4rwhrzgk7a0pehtupiyaktuttkwtvzs15mxudwtim8map7nvmvutktfvattr6k3gffl2ksxhmkvx2fzswc27wfg3w2vbmwk9k0cpp7fviodpi7jivfgvishxkspntltwxbh7tv8co9luqype6r0/gqyeoquksly1qodbrnmzmnyco5k+akoaya6sd2ccewnnemn8pbu4bwrjuyxrc3nerzyyzor1xbklawu0bpyg3lnhedp3rze48ttfzf/fql6kofoxyrhpjgef+e4yw6pdaxzgyojm0hgskjrb9q4bhztzc8tppggwgqikazuuqq5uvvgporlpsmjehyd0yfeyzfiw37wi1v71b+ifrljkkklo5mu+hmfnqymxepcxxdkxfpntadsqfkpgq/4j39vgbk6jz7cfpxvjwh7twmzwpbyuket6rwc1iy1xttujm802uxs1mmzx5ho52vqobpq1zzqmrbhuri8hhbbguhhvne8uyuqsb6xtd3thrrvhof8rqsowg/ufo+pifvrynis7snpzb7xfqkqanltbtcsl9sj1pdjqk/gsta6ogez7wen7aczxhzpcwxyxc5rszqcvpzwjxqyng87puwhja2wiotdrobmkx/apa3eica11rpg1s18vm6ipazk7phfzxkzcbvprtsh4tpikupri4nfkkkkukctlbf1gxuwvzinqorzhex5/5otlzbqtgmpfhsyjxu8lhptu0zagcqlfvni3zewutf6v29tutbmdw0sll790f3q+jahxxbpg7f2/ifavnrjwpmsty7fo97r/mtcwgehqjlrxnvumvhclyytu4rdzaquyoca0wa3rrftpvzudupe8mdb3dc+v1rywxn910r0u4cjkqv7m6bhal7ajkpaftxtzuqtl5bq+9qzpuhafjynnhyxt1spw0myighumm8sltcx2nil7j4kvwp0wtcevk0kyy8nr72ueqrmly786x8uypvuglkj+jduufwq2mspmyv45gcc06h2h+8l0g9j1apw/aijuncwy8orzhgcxgs2zfcvw/ifdk77csgf/js6vgztpduqnw/sb4eiunmywoiply+ftcu2sbtv6akue/vpnoqdpla1nb8dn7p8jozr0ylbeniqyvftmh0y8+vwnsqzms6xi9qrxe6tvkqwnpjzi2srjllej7q5glbwiw3nyldognjtck2nl0o1mlvd+6nyrccyjjljub8bkzrrgr5cdqrxfu+seaazjb9qik8jynkntzknffei2kv5leqhgwpnyfalvdsqwaalxaenmrwgtjj0cy5tzuzrqfdcuiiqpkyvngcsdmht3askdq0ki8frfrzk7gndektq7s2lzvnfxftnrclvabahutniyj/agtbhvktzvspmbwjs+l2ubaouf3n+bghtkl2rt+yae/jrz5+ioouppkctbyabgygadly6lipabsbdao6bdapad2qzu53ulfvbffa+nipyw079zqdtw8iiur7vegtdwbyx11vvb2reufdmzmcutbj7zmal+w24c39pwlfmhsze+g919ynuvuakehnytar0t+xvzyw9jpueptbu+c7jcqkmxsdymfpgxa0+/qox6rebwsilq6el1w3ngbsbbwrg8oyxqaojltiq4zhoznz9htue+6zhrl7hatu1wlhn6i2o+ksg3jjk4ncblf8/mfhlzclzci0ah41/yug8yeisphle+ihduqogyrgjtyzzbb5w6lnsv2udxnlslhzxahwcdsrywlcsksoyjxcxuxgu72/neyp9y38fitfque++bz+xsdc3iv9dvb/+i4d/waop7sl53koo+k+h5v9s4d/amop1arfn/pj++xm9x/o5/d6oj6ii6i4qiiiaiiiaiiiaiiiaiiiaiiialwr1xavhdjgghpjea0pvlvf53gkbwhusvb1rgqnc2auc0nlilnabty20kyukstzbts5iwuewtze+3fps3nbhdmkrr5mtdsozbgs29vmhqf0ku8h5n5linayshgoll6ui5lnasvwvv5ncxddvzvtyl3/ah+bz5zrkmwf9bn0a8aos8rf0aog5ciiaciiaciiaciiaciiaciiaciiaciiaciiaciveaeoiiaiq44nonmtlja+vojnutlqjiuo4reqiereaereaereaereaereavxyfrmuabfrg5p8qvt+iein1joi5gyim2dab3dzd8fputhti5kt5rlgtomhtt2fk9wretyi9avydunqdx6akd4pw42ij+xvepjahr0zdw47zup1ufy8tiini03a7ob7raynxhuvdgxyslzg65bafx6ui35qtxhunimxt38y7z1anlm5rml93yz5sxsvxj1tnjm8kl57rfot5ncwkrtxiorckk5ucnkxlciicnobsuyuv038uitsbps+rxehqq/i1owpe12jmult5g6/usengdrm82d4fo9fip5prvwyboipfpyt5gfdfvwvyu1k+u37z9o2a7vfsf1hcpqo4ggqxemvy9ntmbpi0vd9ijlomewosojfvgsaww3cb5kbfvfb6j8ip7f1ijibq6qezb55totngzcafrsvffb5rwr/co/e1fdtbtllnx4xj6q94vb12n/ky+wpujmkghlpv+m37lcoj6lc66wp6wnkcxd6piygogu2ykkq5u46pppetjejltdc5/6n+g9flt2+elxx9rwuu0dlfe/whwwbh2g5a1je61odryda21liyyldr1++y5+c3vm5m3mklfqiemzroqrmcgubj8eaupn9xtsrm9qa0ka23/amszhe1xeojinh71rc9/c3nfngnygz55zsb5nnl+inapgutekhes2cz2a2ydm0ejk4q5x7chmyvfs04gvetb0xs/0ur30yj8su2z9gul+jawlnp5rr8v12oxs/xzc11ze5furbtf/crkoerrkomipb8vkkjbslgd+nvvmhh8vshjot5kovafydp1skypgq+bxrgkrtede1zs71wkoophnsjoc62drhnmdr7lpaotm08kgymnp7ko3qbkhnqspnt26kzcylhtfrha3hflkafrb8z6jvn9ows3tbvg2qcnn+5zrarmyoueesfzne+r9r9mg+zh1lefm87uhks6rfwtbi61gpkuvjpdo7mswgdpknvui5upur2oe04gwps22ultbd5nortfcxxj1j0v0hqdfumata0a2c6ihtjggmoygznpftofvmlq2rkrdkxtlmmljcbk8rlmmnykgnqeaeo4326eru9xw3dibudbnrlbipktw3cqwsnzo0bkjc60l7d9go7hcyfk5zprvfzxyvynloelucjpcanki7oltln1hopeuhcg8ivhle85zmathewan03j5ls+ld2nfg0adbzzlphyrkuur1ksxcoyfzejbwhujgxqlsijtvefbwyixpz/hrx8dlaei11jonlzcsqo0wdvoryh90j3pcgvstcn2sa+zxxmg5dk4jpdnstsaucmzo8r0xgr/t+5dt0gpmg4+t+pzhwkekyl5ou3xqs51u51gtwxsdiiatkfsxqpb1v1qcthyk1jvuthybu0hksh5srwfuzqkmgmc/asnz7l7pjpcyx9cnrkkfq/o+ooyo6vttre0nzivr71owbarckumy0dqabexbcabznfz3fc6wq98lswkl9gv87ek/fblwmhzarmlipzifuhxxfmxqmrhhawv8f8o8qvrlramqm/5q2i17o2svowec3cfkqvnik/aehqaryj9wfexypjryymu2vtzldoqsvotuisqhrqvqll1iujusgwznwavtdsftwh1r4qth0cy3/e9wq4ld3d/y+5vvddyofdxv0fvluzkfgttnyfbexumgaxmcqrupdllhbh12drwk6d6mpr58od8qqoiimm8edgr2h+m4frxacrweowb9oy2lkjcjgalnb0b0kw7y6i/vjvjuxqnhg8jnpogdjyz5c35qpdht0z6dtygi6lrwnbcgd46k8/ilacjwccj78edy3snbe4jd4a0lup8vsoag+xhr7lwvucxuhjrzllpm0cw8vaptvbjxsmt/zv79leoofxdqqqjrcjaliko+vhqenrv9ofph4quw+iqm25c1ljrqhadcextkunyb4nr9yquvljnweamkuysdz1jy6/sxz/i9k8/lo6hzzozpic++3mavosqbdp5ffcqxckcamrgfwgyytoel/waldrr/avmxlpqp4msuegjnupa1wa1til5jtbwsuu+irdc2n7ut1lluhc8uxrcunw3jlex7ps5w6dndd34lpslpgwixadgbpodh8t7lo9wqj0ul3g7rc0+lvezenf8evr42gn2nfto4g8twptrpufqooqn9okltruzijfpdm42+uyuynwhzrqqdvp1i/iuw9ekvybefyrq4hsvvjh3cj+jpscrl5hukz8fqs/rb+qvvbpn3yw9wn+r9iujk/vmrhr7iokaljalx7phq/glsfa/g4s0en5tn/g32q/0uu6dxfdnszj61brrwkm1vhdeikmsqozv97+s1lms+qebwdykrsys89nbrecsfxghebqf4tyhk9e6wwukdcrkqx2cx4gxn0mlprcyzmtqao/ilqzh5btzw2xgpynoupwrw2njjeeablfys28dkdwxwm+khyn6klctxk21execpba/xunr6jiwlajhonlkqmvclswpavbcegw6ktds0wwbhq7fx7pow2dvirkkebaxiul/xbmp7wlw2b+vfq47dtqki1la4txrx/ls42iatmivzc7tgmhgkjjxg7soz20f1lp1ntwei9nt1sljzxrr2x5ma2nafrfdtzkvhogmlri19vyvfxfkvhh2a6x38gn4nfts8mcnb/s+db4lgo543zdkrcn5pttbcbwcrncxj3a925pznedus0/dtozlm0rnpljlb691p5dooqsttkjhtbpsceex0ejqmme6kpqr5qxovmcsnhpssj5g1habcbz7ka8zy6lhiprjtgi5fixae49vt4pxil7o5t8fbu86utmzbcfevusyy3v4ffxrdosfr23bwzdjdojloxfjdy4wa+xfnnpbwhtpirnnpdqwce2mj9naf2r719jzgf84+mqvemj5ab9haxh/sjjt8qp6p3ikp91npm2v46ox6lua7/jmvofn96ufuqkgxx0rn/qxaf+hh92f89vzsf9c1h+pcb/4cf3yvmy/nxm7rh9hp4fveerexrhbheraberaberaberaberaberabvwszxmn7wcdf273vcjhwknh5o5ypxtkgjdfl3fnee+65fxhvysvmxkchfrixpfrzl6alnwfiima2ga4jaqwtm9cg+x6hx+k6mimf2surxk4dogtvg/xvyky7ei6nz5xpc3726jdwqxjjrlz5i9r0wkdlmziha/asxt5k1mwncqhh4bshtvy+icokltw85yylaxjg/mere4aexo3f9fdx3xvu2w5ybwaetreg9l80mdxexqiileciiaciiaciiaciiaciiaciiaciiaciialku7mhmx5y4abzty7bkgnmdsdz9pxijmc5emberkiereaereaereaereaereaereaerexqb6eraeaereaereaad0guhz1lnzbnmajwnqdnfefrtdxne8ofsn0jgskcoy6zid5eqy+kpe2yttjgogzklvz8xjhsvb2kathdc3bavbg5c4r6tlhiphgt7agft0cucmeaadrkhjaglvwcftvmwrnfviigfmsf3f2iot6o+ixwugcse1gywzx3ug6ehmcflhtrpull05omfmwkvtrwqfymwppgg5e50p6yolvgtbiuktatkyapzqtpx1yacsbkevurp3ehrhojfbuvmvlmtn7yfznw2tkcvncmj+eqc5rwnzhzfyxpg1sjb8naxjwsabbyafeqihomuuaafbzsamha0xoizly2zstzlgpc3ltoyw1fiq336g/j4rhdvkmwtnfc69pususxhfbdzlllpdfw/svqtfidspicw/jyryuhradgzsrsdzutjaa3osekevuyyr7kyo+olnjipbxbwdrvskbmtg32br4rctoaksxxmq5nrqyzofrybon8co+k6p2wahqfcut+j91jn5txs4dezjt80faux6vhnw2a1n/krmh5ovwv5oj5a+9y8bllma5rhkwi6h23uplvanixegx005zkomzaxp0u4iwaw3a4w6+x3qjcwdtzqseju3mjh7baep9pbsqrpc3+w42wtm4toyymycnqaff1uppxfyfdhzpfrcvgsya69ffcz1zlijcynoxyuz1gy1wxce1ucqvsqulkwlldtitedxwv+okdrcnfbr7bzvndcxeuisd6op1lxroi5zt7ekvhznvhtgnvtc8ad4lehhslq+0cxvzp3lpyblbunhvjjvlwdrr+nlh62oloxzyghh2fnrp4jopa+k5n/asws7nrslnzhro+d5qoo/vblwpg0a+yuxnvlevlwiyxyhzrsfhsuwsy8ilfbpctqc85aokyy+3msmervuupbivm72bz6rbxxnswctvmjkjpjcwzlrcex/fui4jjnk6keen3rnkjj63n7gctwu2sby3vy9p2lnnpewiz21tsah2jez52ydqjqtloddqrud/vfuxuruddntxyhdcqxvuvzkevy3lrznnpcvtv5uytxhezvslbax7vbynkvop76jsbmtszy3uqcwpwq9pjqskek2ausqldtfzfs3afdrawkhzbvez5dzlyndvwuz+roxf6dzssilvq7l6kqgjsaqnvxr32cxhsbqtwsglzuafhwirpjlia9puw2zaw5h2r5nxag7kpqi7w7orzdorcg2ub42v7v9ivkuzzvpkpzz+pwxf/spshlaxd/brryohilt2/5yvzpnxny4ewiu44gmqyj1jbqsm6xlliydf1vj9jokxcbc6xmg5jr7yv6wjxlu8cywxmbv3vak9ju62emspddwhrxhbkynxxv+qd0qst9uh3kjxx7lz1fhmkiadnssafivh3razusmkbi6n/0htf7j+xuc+oyvfer9f4ztmbdggkgzrci3rx7w+byhw33qi8nyx2seb2ouhnbhu2unhrqbb3jcvgouhyas4npzpxslrk6hl0aogwtkjas7wx28ffbeohd2ka2b3t06lwyjidla3jtbwco9tprlrbfbdbf5k6swzxe/ok2mazr5lqpokbrzcl+9bx/ill4t7isrecnb7f5gbl3s+pvnzuxjdtv7xh2prsqrqlvnvj0xtkqoelhcq4opzs1j5ntjhn1l2g912s2r3uc6uvq8vwwtsmbgc0kfztzan7x5bbpjprlpbgkpy0s4ziobongdur7tcxogmt6r8fmcexcohy2oamec0wzk0f7ldc4b+2ylnngucrjbgg3gww2y32c2dwaksrduauwtvxhymjt4ne+opj48ojdne5jc1nwu31iffcnonu5bgzm4dqrjblm16x02u6xf2wmkdft9qjfwy4a7mxw9xnrfup7al0e/8aimtp4fszsmeqtpibnhlc0oufhylfovcw6rzg8swy2fvve380uz9v+jza1+ensvv0xaj2g/5vselt72svjyk0ftlhma5p+c0t+h/pvl1nhjxkplsr1ikcxf8py55q0dpjbb1q6/uvjlac3upsegct3qdm8m8x71egctc+wlvavrtgpx7o8wr0jqqyhps8gu+rj2xsbtctsftfdzkumg++3ikvziw4ryxrgq35dzztqaceqvzafgfr8rqlambud057crm3hcgtqxmas3ifbeomnahikxruoal81ridtkaddsm8bsstetqnhg0unvwz2qfuyfrrh8zkzmzmgdolm93nqpnu00oylx5rybqgcnecmptro3cdhk3jxhvdlne8sru7qqltcll3mcpcwaew3h7ffuf8ru0xoorpvpvnq+sk7t8fkuoitiz1k0uoxncnwnw/wfdfzprufply6kk6de2vmd/grmmvibknoqxdcdtnfqpyzma+sswsa6ajvwtmitqvqazxisxizsnzozhln0k3ns0exa8cte9ugwaiwrsxe697yebcinyxktwkl/dulse3lm99wfmdvvrdloyhfoulnfk2btmyw7j5aymxyejd13xr+hek45/ybnbsrr3oz9y6qplncxeowmqbdsh3xz7ctkxvbu06k54he2zdomtgqmuvjk+avsvhmsojtypblkm0kumtia0ai/uw+pfszehwj4r4whxcb0mrbh1oph60b7aob+ts05axlg0mshye0axv+npybe7bhbhgmdlpaisnmjs6i+ovzet29qvjztbrfpfy6bx9w2sloecmoybnou/vx+psc/op8axz/sku8adsvopeg2wjaxtaefqbwrjyrxmvrg9pp4fvearexrnbheraberaberaberaberaberaberabaergaciiaciiaciiaciiaciiaciiaciiapf6iiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiajvhuhgkpe63cmajwnncnvi/mcopkw9bbsfjdi/5bi3jd2uuvxghegr1z67+q2gg2uudc7rmqckquyz5spsp41trg6t6hcsdkipgvpnfnb4vafuxw5zrc1824birqwognb/s5axdqy+ok+gtvnky17ddr2b7d+arcfwsrqfpe9xmadm9ucero8drc97ig6wcbv/rhk69oace39gxkvcxsspo+w8bdbojitv8ajxwazubwsi2dleaatyv2v4dsbecsiqea9efmjueyk+n8sqjii1b81df+ev1qkphuvtrfxbp9yvchpdzqviquebxuozwf2vgoal9vjzpuuueklebqpf9zxcme/x4ap0y6pqiz0xcvi5ppixfzju4lx96xyrrgra6dgdezkmfalqtlfbqny6lpurvyn2n6lmfar70w8gn4rpua2a16/tk5tqy/jv4g5zfykbcilljawjgw9padvyfkaefot5ldmwzipgojvuzyggnqsy3q21ftwpbuzhojc53ip2lnbakqfxpnp6az9nzhmbazj0zhrxlcinqbennjiyctodp8jslizrhduugh1egu6mq+dihg9tgaqkzdza4melza73228afths1t0p7jk03gyjakad5whn9g5q0wvd6jbd6tvrawzq4gbyuu49xa+4clt2uofuqc0apt4rew42vsmedv0ugg+zxzo6n6h0w0hpw3ck52ggygw+i0irjfyrdkcpfwck6drzdwhqtvuyi2ls+y8gpxotbnikjzoco6d7smvbqnt+89xnhsfbvqypywhvd7kforqs47n8wvlwkm51pvxmmwrdxsqvqpyrlccgj2yjhhgibsccoazpjcdq0b/upygrjhpixv37oga6uzwadx3cevs6hjv0vjzia9bw45jtgumanmlyblp7vio2hmbex2lrhhoa+o2eblps5j2qasjg5n/qud6tnroun5ws2gewdfu6rtcuyq2opph2re9rs+k2j84hi+9sec/k/1e9e5oe58ngq9ks6c1ndikpfti4vufnmjicqdcncphovxcpx6q+hvk1t2jg2iqbvbbzr795qibtzeh29anamqke5ylan4cnb9jpa6wurtsxg/u+9wa+/przbnb+pcpio46fesrghbplfzeclshpavpipvhv8aqx0nttdqpd7lzn0zyd2mlxufny/lhe7qh2fwuko0czxpxjuxbg3qnhwqsi+xu/iy9u+61txuzgk9bqvlyo1k0gk1ic9syprauhh49e17sm4rabnhfe1z5ncffcf9j0ztwta03lkenr/b2z5t7nn966ri2kmp4pjpdyn2an3o5maod1wbgmrfuzyzptnkdrbywfgb5aak30s3norkv2495devekodza8fcvyi1qtvd9aaus+6mzn5kwarjafzhbosgbopluej2y8fsv6vjnrkzvyay7g63v2f1svwcwsohduajilfzua1oxshv1jvyqtllpmsqyso7x6kqo/jwjn85wa9uwxtguxz96neibe90ejrnec0z6o5i67hhts14v2gnlyv0ngtlpfc24ylsukbpk5gxwa54jbp6txfr4rw8qvr2xexpy5shvpnzae8whlcxw7paw7wnrr8fg9sujnkeebgtkyeuebc7mdhsts/cjtxwfl7jufmacigbyy+vreritxc1k/vib2kuaquqea9sxfihhvpxv0rxgspfyczoqrrzy6rifeplyvpwtvqpj5pjyvvdjfqnb8b2ga2ucfa8vco45tw5v0gw+8bqtpynxz+5rt7scqdwtg0qnxw+xltgg1f2i+/mhr0kuvounvri5mksjeroce0xnvass+sxmfesxsxsbqrqsnf+umb1ahe53/+y2a08by1i6pa9n/be/8a2rciqdmrvv67ciiiiyi8yp78q/mv/wbx+5akols63ff7t2sp50f+m/etw9tmtxcwh9pd3hnhvni7ql2njcrhcrtsqmi/garymtope/kc4+xyeuwzxcvfqdmnuqv6nthybliywl0xz3bsbfkfgq+uyptyc3eizwfgttbdrdnnvswrvau5srgisfddvcdfxlsyhsnll2gn7ovjr2f8rv0sp/djp5fjvczq5la23/gqmuc13aqxpvq5uv5p0hofq+kzb6ogpi7n0quhkfsg/wdix5/kb5ruu/mcvoyo67kbk0x3t2lvg6wg4+d9l1utoxawwpanzrftkswwpu306almj3soeppkswv3q309c2ssjyzi3itimxie6mu1lwhq+jc0r6wamh7kjkwahzqa4u8spnvwzjp83dxhwwsq6xs4zwvrybqtjf5jsjhm/wccpsxhiw01arflfiyo/wbm/x530suqryb2o8wryjzbxyzh1ferlhnjs5wddl+f11/gniswfwppnxbta55/8zp1iqyi9jklyzntlv8m1j2i6svvlurenshi49o6eauscmzkomeq4/4hbieilbmqiregxk7/ape88wv804ttvje6krjo3xuifg64icf9mkxc5z6rvrw3eggaeblxe3uu0dzmj/zvpxovptnoehwmklje04tw9rgssnvl1nd27wx0dxndkw7cw/rjsf7dvxhg8mcubhkwsc0lj43aeohky7rxof8aq8n8nfqbafjju7s7ymjrmcdon55/qgyii6k88ciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaciiaovtrbug1tv5qzzzmzf/ah9qxnfylr6omuoo3guv+jjfe2p3qun3qbfoe/8atcfclvo7xyqvsbxosycgenlc6tj9o+kqxdpxtzbtkmmp7ztmuahtvosxpvzcrfqyg65pvc2vluw42x3fllrm/h2qtkhkyybdzggnlixnr87ar3nykuq28lhvnqadycurbmbi1ya0+5cs49r88zygbiiznfpnl7h8v0filfwxtkkj0y248xcgfxkpmmj3vcbl7i4+/zx7ci5t1vhfur3trrgoluyzlbv0q2atvmws7gaxnkb9ko/xxwkaaaaafjqvypgf/wdpof7zo3j4x+xdkzzrb625abnzxidb2r480jbsx/cek7wdxhk1quqme+xlrgpo7u9p5jsuhjljz2angpdqt1ft2wfosjsus1ksrg0+hnhzb8zmust1jwypqcc+ivxqq/dhuq8pt8kmp5k42wa8fvwoaw73e+h1lynbofra6olhkfsacpx7ve6c0q2/krxy3sxy5rr5lflqbramrqpnlut4qsbm1p0lu1kuf5imhs8zczvrwc7nw8p2lsz4457srblh0jv7bywoinooz3epu/yfdbrgkeesoxvz1w87imuyovxqk6k3j3jwxhtoacospp7laacdcxbzcpoxi17my2mddw+cuc30h8fgsyenda/tpxwfv04ang4fo5vrrgkk+rmz7m9jc+dukjzlw1bzzmcpynpsxuflnvas8sgwmg5hk9ydq1y5xxrextq57pvmhaghce7hdf0siqdwtznkm3qsapprzjl6pku94ye8z1fjdug1a2v1/yvnrbeih0szxtswkgsnivdl9x0k+g8llzixkjchne0oa7qcosq9dt3cqqnz/ulsa2uiovlgw2p2/akvirjwqosxp5loslcayh8qpjwbt5gflytzzjkppb2rgp4/9r6gngi4dxjhxyesmag2zke2j6zsdvybhdx6pxovki/evzmnqvliovcafikvceffkaqgo12toet9ehzrslr/aki8htg+dzdzxzwk/rb3w/dvnfpbngowlhxkqzwt2dzwinynfhzz8z1rc2wve71rgtmmgtj6pzndx1ay0n8bljkhpfbxitjaymu6ksy2jlut7/naihxuj9khfhyencxjvyk944xzat3n+y/xxa4hajx2/arvcippuxfyhrz04s950hjtiq1mpax14yiwxfpnn9zd1vy8ffghbwdaz5gxvjj7rslxdvzx/qces1mxlc5rm5xnja5p3bb2k6yjsp0ykeeezspocm2hvssdjc43k9sxhvztrzsy1v2czwencrxhrqnswnklbcdv64rxo9pspfycolyq2vqafjw6jqbjp7rbgpg3vuvtlq6wxk8lgqpyjmgctuy+hszjwe6brt/txwmdxtzlwfpz8lyux7rnwzhxxd113n5hmfz/afc0c8ngnzxmaeyy4z3xgsvhywvwopjih6rgi6lhgjggj0pzmupzsuoxz9h2lnqmti7uaubyegc9if9d0jcoy8gnpcupvqphnjrz/itv5xklplovrmrzlaynvns5skymlwmbkk4qdob9u6xziirk9xjgvgm4srzgeqkut9yl1rbiy3wbqb/+l5zxhfuzuyygtcqxand4bdxvyc1eju4uhz2hxazm53sszfxka2cg5dstbppyqh1miljqudi89tlbtdfl4ku9uiuwndetbaxxgtuqbkslng+66j/xng733b9b1vqvbdfeyp4powoee2l52bvimjtqpafkyfdybamlhljdovnmxcuegojf9b7xh3rdkfswix6purbusmaon30mmp8a2onvdjdww6zereubeadiimjedwpucwn22p2fatewgedbqo+cmoiunaron7dm4p8a+06ffrgrp3ym9rwfvdzuuz6s3k1j8tzvr6ub6xwf4gtl/aq3ywgu/ikt0by/nzj8b5kxe5ufyteylh7nsblanmqycojpsruuvilhqdfqck4vll3nfldzivezashlorhykwtur2rj5v48k64lhldukyr3zra5y33bvqsyak/qud2e3qg+4knvt7krbcgzzagj6bd8df71rulqgzq/r2q6v3dhfb5k9ik8dt1k5vcsoakxb35gdoqmvgxq+ryp0t0kyt0emuod0zdjfw+3wwjnttzvtn7asqxtui99rbeasfwpirslyq8zxsdw22b9pwo8hztuexktg5m/mndyr4hry90b/co5rluwqjhsmkilbvqtjy27ro5+nleixzs+vwdlldma090h9t7+ck8kfu6fn3wtmwmikfkxmj1c2whutjpbcjvbxm3b7plpz8/1oi8hcrcpjs42mi7krdnejgpftcorciixcogqgttkdw+pjg03l233tzsuz4xxnmyyrjg4pahajoqommmc1f23hvhjg3sblddgcnfhnkwrhkpytpzmzkl5rz/jz0etqykmnyw1kxea/zs1vmp8dncrvernndsj7vnzyzcjyz814ymw94knsrlhrt0ij8hrfpp/afqthpmvcrmnrss2m/h9uc8rexwhnyreqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqareqbyuomussybvfelaz6oulxriccdyjuo6g+4qrxny7g77wrxf8tpmuc78rdaozvjbr9vgyl8tv84ckcsooahsou5ju5nh9jngoo3c+imoxgkejksugkjelhw8tiorwbd23hzyuga9gt4kfabbjqnvbllvp9qalby0lrp4qo35eqiuyz2udxrewta4ucghouxhydqvlv9bbmsqabcuplxj5ljnf3e5qxgomkqtorv5r19/jtulevwwowtwrgjhpc1/evedqp9mkifh7jfph6blosfwvsvvqpqc0oxzzcm2y05uk65wie2qi2vc1si6unc42bfklulxa/xxfz4iwwghtp5axsvngpqg8wbj719hco1aqkwnm1vjc0g9/wvzxhxufcx6qu3hrvxu/q07cps4m3p6cant0h1loyxwomwsogh1lkyfyt3zalirjcutctnv0nktbg2xl/frfjqz0umc7t/bvdh/akb/bzse4g5t7lqujqavfjuraelmzrbj1hqb8fztpaaszpzfi8stoz0um/kc618jd38i76i6rau7xclwyfhb44w0xeeulstvcpdzbmion3f4naes0rmpft4exoz23n5snglwst+ha6jzbxlna4c5aaphrx5k0awa10jvzbp71jnty2k8m87feubg4v4qupawbpngr1t9awpjvpvz0ci8lvd79h7lghh4vn5aiwq+jnvy3yj6hhmuvzblplmutfyxo3vno36roywr3zq0dnlq5t4oxu3jzxyabibivuhmk4moanawodhy306lhpg0rrvyr2i7jrwd7x713mcclxj0qyflnhma/hwzhfpd/wbra6dnkvpfdphvkl9hvsiozg+k6r6kejwqakr+rbvp3o6fojh1j2rknlfpkp8ujji3zxxud2uhigrql20jc0xsfw9jmy3n4u8n1kwqsdwuc4s4jbw00cosherkz6l7ai3rsrgpxfqvoatkvkbhjbry2cprklcznfzj0h4n28dpgnvltavbbd0fzm/b710t7nov46kmy1wwwk9tk1rs0gsor3ni1abuvb6fvntrkuflobocnbxz87xsuc5rwt1e4nhmf/a+peemmeeemyhqmad523xz/waj4xhlirgro7sgov0rxwi7gnxcctwf9oydfzoxaxutu4x+jstokfnvz2+rmlafga9sthuc8ndwlznhyna1jpjboolscei4h6yokcrrrxv70wd57fni+aw+abgouwldnlsttoc8wcqorqmsxamdyfh5rg726nc+a08o4hirf1fox3h4arwpq9zrrqk85bj/qcuopqkecm2kmca1/wbblu8qoiwbkm5j3p1kq45916aui0xzsvugo0vaovaesgvl3jue2qlwpzewhsq2usqv6mzauh11j1b2v0lhm3rvfqipbluijvl9yrkzvo7lqsxq4hdzheszzvlybwsftqwysiqwz+gg8zo9r/tc+0clrr4vwuimopwbcumja/thfarnx5ri+vjzgvewqpb4dlthuqnbkmldc73ji6qx7kslwp2moq9gyt7hwkqgy9iukazukcvqvb9spoyuq95+sinkkvay1tchwu24pvaff6evmyu0mjbeadi/lcec37tljtwhzdcxttfkbah4p0jakinysu56xk41jmi/kkqja05m53m9judyghmpzbfzo8fhxytknpo605tocwtvn6ct1kgnllbm9wpcaktkin48e6vuowzwsb9frw+4fswoxzuz0bfpsmafa4fet2msfq4ia3y8reujejqtscumyxzwaaovincznb3gj5o09/vsre4mmj99c0xy7ueoomh9pxo5zhtjdxfo/n5hquv6pl/uyx5s4h0gpn3rba4rclb5qqok++gvlspwztya7rvwgyssphjug0c8ekysqplu/bfr8izlvt4wqsrlnba5nmk8lx1l+izz3ru1mnrryl1cgwyuuq2vc7f9kjpg76lrq1bnhln+kn8gupwvwsvuzv8asn/3ykv95hqotqr019nrwxw9lwhra8x0vy5fxr5gcn+nnzk32pu8tmw48w9q5hpeb24hvpvqqnpqu7nw3y+4ps6rilclgkxcbo4aeg2ypu1wsbhxvyt2eib5nbnjizuxfwpzm7/tvj90y3nlmyebtnwstuae2rx6dzhwpu0txjvxndfc2f/emol7e8zxfjrjo3exdt+x5t9gvrammbjvmaom50us2tba0kxzpzb5pjczyssd0c43ysdcwox4kjrzleguznc7agb1y0uplosfgpzwbixgiic7uh1ndj9gy0uz5hekrzlc7jnbwkw7ogojdch1gqtv1tjljbvtkc4ogesneozw5oi5q7nuj4sxwymdxgtc3qg296mlzl81hnscdxosptcjdjnimuc9jh8dr/pv/vc3icth6qz+qov0n/qha3szzuejn+vxxzz+h1rz1erdeedberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberaberabf61eacgf+pvvpakotvos6lnz0gqvkoueab/imils3ndvfvrqvjifmy7+epn3yo8r9e+k0gdel6bkkksshxk4vko84f6qaopshsimkohhmial/mv2kknvwxnyxgemntfpnbb3r5lzl3odrm3s5t7lrl0+d4ec3g9fde04y4t7dzoyh/kge/il989b4kfleavylsvoomjvq1howwelxyqkpjt2mkcftzvlueqnovd8wx0bwtvndq0fqrcm25oacp0/qr53p2xcpdx9i7d6nzr0b2l1zfuobbpejjre9xwb1skp27z5lm2fr4ogi1r/abwg/fmc4ac4jpt71bcw6aelibm3hsw0acfl7nk+j1tjapjgppwzo/yknjm65krjx3+ahadyc2pzaxtz5lhmcjdr32/r2cpbzvxxxjcwizy7hsegjyucr4kq1u4ghgjm7xo5yrzva/pc082uh2rjycdpafiqpxolyl6y3mohawds5w3e3rkh+e3r4lzdpiobh/ukyu/zahdxt77qrtxc47pjt1pimtgidcbklx/pufcfmna5e5w87tvhzxwedcpem5gmpsvcf67eyszp2tkheekh7lfc3yj8alfqdzkkjhk1xppszq56qvg8mgefi6h610mekjvflf2lnus5mjxhmbft3k9yvfdrwl7rasdvno+el4vuxorges4c4m+rvizuihmsyuddyf7f9ahgi2rhznxb0y1vec820drzxymfpoculhtnjjmkl25rhc52us2zr0cxop9kjcsvvc9/aafpwx8uxwo4spnlyct8mbgrg2dl5f2w9igwoyq2oqshpc5p7znkvcrz19pu/p6kpjflpcvgdmug6go0ouuvdwdsgt8siz6nehoyqqyxl3swtgd+atc28rwxayhzoup4poozjypm/hzs6v1hcq2pucnnlopbqxbdjrcsyuynhllknmrml3epro8yqpavlxfstfuzyzyg7pxl58bfqlp/pj4lzflgx2/5we3/agmpxpuxiyr1rdedt5zsuj5enypvskkps/va5boikgw3ra1il4m5unwzajvycxhve5ltjjeacqc8zinoqr0vnwmi8yoyasvcq8dffvwhvjgd3kvjpgpv97ljlr1pidevnaavoq4qex77aihzvyefkkkzlofbussy5grwzgtxulruaqed/qbfycdrtb5d6l82+ixhoz1xyt7fydmr2zpzpjtbyx0brhun8nf551uvgdwolst/ex6ucryxikwyperjbofi9yqrqjdenkehavurcakg7qu6ovqkypv7f4i8dysgeoohvuqd3z+9xhqifqequmsec4hjdq6te29g9syguuembja5b/bb150wvwil/hx/amrni+/hmspgas+qfgtilwjtb4rpq3pum6rgyh2cw+lm+5bryehxwd3nd5sp0ad/et7gsxoqpsrtezbegx0c8wpx1yijlrgfxyc9umw67h3j9tr8argnnkqxdx9noyq4zhcgv4mlhzbjxa59tzon7vdh1bas9ua2xwflksssbqw5oo4xduqekufcgyr5nwup16jq1d2/3gxmym6ehx+9vtkhjzlwc1ilq26adfjgj1plbqjyxhe8q42cyrypdxmxxbj9keq87m8ysk2cxpzoimcptmfvvtofqnnuvsjw3vdyxubnclsizkw04aebush0muapd+xax58fk4j/gyp0ux6jufb7jxsnxpcng7pp/er0qko9xtzf1syydcaex1huxsa9bffzjhg+zx2liwgessbizhmubuvza27hv5q1jq3b3hx/adtb3hz+lultr+cvoza2dboemm3gnygqpjjy0xii3d222tqfzfk4dr9z0w9cr4hqvjvdpc3tmmokj41vnefkkefm28e9qrjbitspdwc30jbvprtbywungdspa77ffkbahvt7gezswov1rgfyc9fojn4k9jgrqsw22itbzusv7hnj+cbrr9fio3kl5l9hibjfnzp9ma38goa6vhokcrrtvdcrtz2o9x9o5re4hwoy4ztcx7w16bqkcg90zvulnvyalyjp7zavqvsd/f6hzf8aqhe0lyhaehducffxag83/qhahrn/an5r576rr02ul7vqiaiilszzyiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaqyimribx9zlqvw4kgusse9ibcpshk8f4b9fymiggk3lcqul0jao08ubcukkhjgxizrxzyql4uawy8rzmvxlsybgeuxxocehei/kkfmhkgyad3b5fhlddw9eltmgqmn1hojseocwdt2xuxhst10d0ayky6mkl5szxxu87fzt722/rfvbum6lgs9mfks0jazpnzmherql1m4wrc3byxddr4j8fynalwyhrcpfxix+f1ceantz9ygq20dr7qshknj7jsb2uufbykmhaf7tkrwe8/pypr9it5dfvx88t/cujirk7ldyyp8aefgvcyt/ac4v6mdz8wvxrjod7kmrdr42brkwq6ato+ecsv9k36nlqkvp2bcjcen3o2ewmzbnate6w5915kadyua38y1h5gpuoasa4vj5dw3mu9c4w9jjbjcbqzvrxtbkvkcoj2spfzrj8uzwxvdnpisdy8tlzn7w16wpuwfimvspwfztrfckttr88csyz8nqpoutxxb+idr9a1c6n6vspdzkezo9drmpd+cdcx9hxov6fzvvgorm/l6gfwhom0aq2oiiininqfhqqaqgrrgdp4g4o7wjoc7vs7sg+2ylb35n2gubues4bgekgnma8hunsrvvvvd2wcxnlcrcfuyo8oownduvdltw+ddtqyqwy+vs/wbsb4nblavhemjtghlkc6zy2f7vibzteyzw+iuuzemivc2jdg3tlk1jyotbbhzs0ozxhzktswg5hdmxxf1rnlm83dk8u8hfrvsacwvckpwuljyzgyletcrsblxljcigyhjibc7q5gdsta+2/wbapolezxg1zco+xzsklm6lokh5v3clrucyipjkuusy6f/ix6wvjdhu06bribmoezljrbxlyhnxty2/ladl3v7qrc33ti8mhmp4uqg+34pwwt2zoy5235g8x1a5bufhngx7e2nufqduuqsf95jdutsfvc8yvhqgw7/n4lw6bg/45pqm/wc+gc7ze5vba8/rkrbmjsgg43295pjskcrmfrxllaldl9zwv0b+cxx1r2giiqxei8scotmvlmg77rgp431esumy70r2xt8yf2rfdc6lsdggrjhxkhflyme1itscwkan2klju7ubhjxxhymjbzpo/h/a46ocgnjfmxabztluf8559qkthsr0kwxmstzf8wph4lnptqffeyxm5tcpcvk0gslyvp3v0kgc5vd1mhoknk8qjcgvxrejzgqbxgc9kajg9wpvb5qslwgklieiohyekyzyppzhkhmdfmxstpic2ytynqdmpmihrssxckpxziwy4qxrwj5oahu5+5yna4kedc6d3raubotzio/+im3t2h1rofhclalyyhrqaangld3br1evdviw9xhooekzpk6nhe2ob5awi2rwbf59onvc3vdh4rxkutlnjms8tlibwv2hfgqpdf2l5/lfck333/atbpthmo/guruefu+zi8o4xewbsre1apnjr48+qkljxftsbthp+jj3t71zw6piw7c4ne5+46rqq7r1x7p0ovsed6rw4dwkfv2pkuqrtvb6sj2/okhbghisqztuup6vnken2u6m2p0gp/cmvidnylefqgmxgtspwbg/+ryrlbx2751i32okkvzblsxr7qpct9zjgwrhlhgo+on2wuaz4vyzd3qy7jvh/wb2f7wl8en5jy9nul/c+n6m4kg6x3nwlk4vadqz3tcfiu4qdypx7sux14ezdhyxh+h8sqocymhz/peotu8f1soe/isy7ny32xwdw5jmhq6bo8bpfygacxsoateli0jt6fy1y3nousyul9trwij1ghhpw6xrpnwcsw9ew+yumniph8xkzhwa3pub/swwo54pu5txywwzkdvszt6i5tr0vwmy7z/1e5usaweexsdmq+azjhpcx1z+n9k5zipnitgmhmhtlp714azu+uvlrvnm3czuqkvna07ax0vf60uexhnrfjr5aubc/pvalelhi5htmoa2zotnlzdb+/p71bdglbdlywsobjcq0arwvu3qazdoixzye6nl25dat1ltjc2vfu2wgynbebgns6jcs1gomav7ntbw3vv2kju3xxza3hmfengtyvc6ob9qtsbdieg9ywt5ee1ryjw8ok9fk4aog41c0x2+koq3pgsmajw53uop/afoskmiy39w233buh47t8lw+wahenhso6nfodmppxckjz/0xgo2knj95raurf1h5mereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereaereavmrgika5e/zyokiscr6qjwqobescni8kigdwoeriierwoiqd2c8ciiyhbcuhzeteokqt9w9iwytc0koawoa4bg5t0rled6hjgo8/twrb83yrf531l7q+jtr5mvicdcx0wnmyatbt2lewt3jqzjdoqtyrnjesnxh3kiijeki6gdqf7tvvwhuejzxhtkinosjivkd9i+8q/diqwg5v1repge+c9i/waw87bragqx/s+peqvuir+6ztjnhdxwwwefvkimdjgpxh1fjhye1eu8owsedlxpbmdmpgzu7lc/lp63vczrf3fsl/3shx+rmw5/msbvbeotermzwgnbjvurhtzmfm1r2m+ovsvoqmjajaaaaaaboaogrfl3/wb6jqwh3zetpt3w/oj6lz70lwtfr1mzodljejfb4doqiiofeqyr92r87lufewozx4iikfmyl1qsmcdztyoif9usirfjttwbrn5trg5iwgm4wagdpimo020cit1pauyuwyh2bjbuxf9drrighbdhcxuaslneyimrsf7hjowi1mj+ep1jka1lwacsbmwrexir5nzjvvdiq8i7re1ljzyq4lxvfqurzdxowesajacryerv5ckh45wnfj3oiqq+sobqp82guekjy97obd5tc2nhdskl9yesivobhjxekvn/u0oxmdcqooivjtwoijuivl0oiciw1wernxi4pk2ktsrekuqxbaqxg2600gpctvfdeutj/pxujqxbecwa1gdjych9aiugl91jzfslkruhxyv0szu7smzmoxs3oycs2ci/uc5kurdlafyymxw/mmlwoiseyc9reofkfesmrgn6l6erapqqsvutgawthzrtqw/lwfriibifs+/h3o7y3zvswxj28jp7krvocnc1oc+/rt+ebdgt3hk+3ldeuhx7muwvvqsr+jcruhafete4stjlu80cidckg+srysnerogoxd83gdfiv2b59urmzbgy9rgbc21wjo0aegwn9x5oiikwymzox3rcra25xui43/imhf1v1qik/wbn/nxoj9m/6f/vuiciilqtyeiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaqyiika/9ka
https://www.uitvconnect.com/sites/default/files/sign-in-fb_0.png
https://www.uitvconnect.com/sites/default/files/sign-in-tw_0.png
https://www.uitvconnect.com/sites/default/files/sign-in-uitv.png
https://www.uitvconnect.com/sites/default/files/how-to-mobile.jpg
https://www.uitvconnect.com/sites/default/files/styles/news_online_large/public/wash.jpg?itok=qg7vwdeu
https://www.uitvconnect.com/sites/default/files/styles/news_online_medium/public/trump_44.jpg?itok=ecr6rlla
https://www.uitvconnect.com/sites/default/files/styles/news_online_medium/public/airlines.jpg?itok=6fpf5yuu
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/dmitry%20peskov_0.jpg?itok=nlruj4vk
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/missile.jpeg?itok=tsyeq9gw
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/trump_45.jpg?itok=vmddhkz9
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/guterres_4.jpg?itok=ougr67vx
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/bruno%20kahl.jpg?itok=h4_91arz
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/33%20civilians.jpg?itok=iktvyfq5
https://www.uitvconnect.com/sites/default/files/styles/news_online_large/public/mariah%20carey_12.jpg?itok=bbaychjb
https://www.uitvconnect.com/sites/default/files/styles/news_online_medium/public/jennifer%20lopez_15.jpg?itok=fc6dobqu
https://www.uitvconnect.com/sites/default/files/styles/news_online_medium/public/demi-lovato_0.jpg?itok=58gtfkjd
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/salman%20khan_5.jpg?itok=o-tfmtcr
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/scott%20eastwood.jpg?itok=unw1pbrx
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/khloe%20kardashian_5.jpg?itok=e5vdhmlm
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/kate-hudson.jpg?itok=zekcqxyi
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/sunny_4.jpg?itok=6jkkdzba
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/jennifer%20lopez_14.jpg?itok=dxxxmrx_
https://www.uitvconnect.com/sites/default/files/styles/home_page_travel_tourism/public/4_498.jpg?itok=th2nfxwb
https://www.uitvconnect.com/sites/default/files/styles/news_online_medium/public/5_393.jpg?itok=byqvk7-d
https://www.uitvconnect.com/sites/default/files/styles/news_online_medium/public/5_392.jpg?itok=xc3cu2pp
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/logo_794.jpg?itok=cgsbi4-e
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/3_635.jpg?itok=rp3tugjm
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/5_388.jpg?itok=o6iimqwr
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/5_386.jpg?itok=hps0knb0
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/3_632.jpg?itok=brcrw5uy
https://www.uitvconnect.com/sites/default/files/styles/news_online_small/public/5_382.jpg?itok=hi28look
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/demi%20lovato_4.jpg?itok=q0pnw2ym
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/virat%20kohli_39.jpg?itok=smiyb_5p
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/kate%20hudson.jpg?itok=rkgn0tuh
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/david%20warner_4.jpg?itok=gsevbdqt
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/clooney.jpg?itok=sexhkslp
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/pu_0.jpg?itok=v8bwfaaw
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/tom-cruise.jpg?itok=q1m29xch
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/casemiro_0.jpg?itok=wixmyuvl
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/melb.jpg?itok=kmdigiui
https://www.uitvconnect.com/sites/default/files/styles/bottom_gallery_830_x_420/public/neuer.jpg?itok=lli1cmdx
https://www.uitvconnect.com/newuitv/img/paypal-logo.png
https://www.uitvconnect.com/newuitv/img/facebook_1.png
https://www.uitvconnect.com/newuitv/img/pinterest-icon.png
https://www.uitvconnect.com/newuitv/img/linkedin.png
https://www.uitvconnect.com/newuitv/img/twitter_1.png
https://www.uitvconnect.com/newuitv/img/instagram.png
https://www.uitvconnect.com/newuitv/img/you_tube.png
https://www.uitvconnect.com/newuitv/img/uitv_logo_new.png

Ranking:


Alexa Traffic
Daily Global Rank Trend
Daily Reach (Percent)









Majestic SEO











Text on page:

nav uitv business uitv travel uitv pio/nri/youth diaspora‏ uitv link uitv culture news paper newslatest news asia news world news moviesbollywood hollywood bollywood gossip regional indian movies musicbollywood music international music regional indian music sportscricket football other sports entertainmentshowbiz interviews gallery legend welcome to uitv uitv search search form search two shot outside british parliament us president donald trump signs bill pushing for crewed nasa mission to mars us intelligence committee is ‘confused': kremlin spokesman dmitry peskov juventus forward paulo dybala in doubt for argentina's world cup qualifiers us president donald trump to attend nato summit in may us secretary of state rex tillerson to skip nato meet: us state department salman khan, katrina kaif 'back together' in tiger zinda hai virat kohli has become the donald trump of world sport: australian media denim made me feel embarrassed, ashamed: khloe kardashian fbi is investigating trump’s russia ties, james comey confirms us stocks tumble on trump policy uncert... we are creating magic in clouds: adobe las vegas, march 22 (uitv/ians) - claiming it is "creating magi tokyo shares tumble over trump policy, tokyo, march join us for free and get: exclusive business offers entertainment and world news free gifts and prizes every week join our social media "maicircle" connect with millions of our registered users --> --> business quick registration name * email * phone number * categories manufactures & fabricators agriculture apparel automobiles & motorcycles beauty & personal care chemicals computer hardware & software consumer electronics electrical equipment & supplies energy fashion accessories food & beverage furniture light & lighting machinery minerals & metallurgy shoes & accessories sports accessories textiles & leather products transportation property import & export wedding accessories jewellery financial institutions uitv business products lalor ltd colored pillar candles r.m.foods roasted balnched peanuts derewala industries limited. pendants lanoveldens h4 container gustopiu di santoro afvs300 payam baharat dry mint inteclighting future min kao chen cervical c arabian auto agency constructi shankar’s emporium digital slr camera edible oils edible oils cmt cmt view more quick registration name * email * phone number * uitv b2c products wybor 40-mi-15n06 102 cm (40... electronics jealous 21 womens dark blue... womens clothing women's black & pin... womens clothing fungus knit wear t-shirt - b... mens clothing g.a.s tapto cricket bat sports & shoes adidas eyota m navy sport sh... sports & shoes queen size sofa cum bed home & furniture l shaped sofa set in beige home & furniture sound king sk8500 karaoke 4c... electronics roly girls dark pink with se... baby & kids roly girls polo half sleeve... baby & kids basics life men's red c... mens clothing view more   uitv global news world indian asian business technology education diaspora more... two shot outside british parliament us president donald trump signs bill pushing for crewed nasa mission to mars uk bans laptops and tablets on flights from six middle east countries us intelligence committee is ‘confused': kremlin spokes moscow, march 22 (uitv/ians) - participants of... seoul confirms pyongyang missile test failure seoul, march 22 (uitv/ians) - north korea test-... us president donald trump to attend nato summit in may washington, march 22 (uitv/ians) - us president... un secretary-general antonio guterres urges world united nations, march 22 (uitv/ians) - un... turkey summons german charge d'affaires over ankara, march 22 (uitv/ians) - turkey's... 33 civilians killed in syria air strike damascus, march 22 (uitv/ians) - at least 33... uitv video - entertainment movies music sports entertainment more... mariah carey's single gets film adaptation still a challenge for women in entertainment industry: jennifer lopez demi lovato's private photos leaked, actress says 'it's just cleavage' salman khan, katrina kaif 'back together' in tiger zinda mumbai, march 22 (uitv/ians) - superstar salman khan is happy to... paul walker was like older brother to me: scott eastwood  los angeles, march 22 (uitv/ians) - actor... denim made me feel embarrassed, ashamed: khloe kardashian los angeles, march 22 (uitv/ians) - reality tv... kate hudson sparks dating rumours with musician los angeles, march 22 (ians) actress kate... need a block button for haters: actor sunny leone new delhi, march 22 (uitv/ians) - becoming a... jennifer lopez feels her split from marc anthony got them closer to los angeles, march 22 (uitv/ians) - singer-... uitv world travel/tourism hotels airlines restaurants resorts & spa shopping historical places more... bushman's kloof wilderness reserve & wellness retreat nestled in the foothills of the cederberg mountains lies an... makanyi private game lodge makanyi lodge... cuixmala the legendary private... unique garden hotel & spa welcome to the sanctuary that shall improve... itc grand bharat itc grand bharat is india’s... the mulia the mulia, a stylish nusa... hamanasi adventure & dive resort welcome to hamanasi, your aw... cheval blanc randheli in a preserved environment, forty minutes nor... royal malewane royal malewane is a luxury s... no front page content has been created yet.add new content demi lovato's private photos leaked, actress says 'it's just cleavage' virat kohli has become the donald trump of world sport: australian media kate hudson sparks dating rumours with musician david warner hopes glenn maxwell can continue playing test cricket for long time actor george clooney surprises fan on her 87th birthday cheteshwar pujara gains no.2 slot of top icc test batsman tom cruise spent a year training for a sequence in 'mission: impossible 6' casemiro believes striker luis suarez's absence in uruguay team will help brazil mel b files for divorce from stephen belafonte goalkeeper manuel neuer out of germany's world cup qualifier around uitv connect channels today showbiz & entertainment rihanna & chris brown ‘textin... scarlett johansson at 'ghost... donald trump insulted one directi... justin bieber performs in purpose... blac chyna and tyga pair to reuni... music don diablo & marnik - chil... tony junior feat. omaaj &... ryan blyth x after 6 feat. lut... teri fizaon ki - official musi... pop the bottle - vishal | shek... lifestyle kylie jenner pumps her butt katy perry disses taylor swift... liam hemsworth reacts to miley... rihanna talks about her vma no... fans blasts kim kardashian for... sports wriddhiman saha - chesteshwar... peter handscomb and shaun mars... steve smith 'rubbishes... virat kohli says, both teams h... anil kumble says team won... advertising b2b exporters listing b2b buyers listing b2b market place b2c marketing about us privacy copyright terms contact us ©2017 uitv. all rights reserved. designed and developed by uitv jump to navigation -->


Here you find all texts from your page as Google (googlebot) and others search engines seen it.

Words density analysis:

Numbers of all words: 1061

One word

Two words phrases

Three words phrases

uitv - 2.54% (27)
marc - 1.41% (15)
the - 1.41% (15)
march - 1.32% (14)
for - 1.32% (14)
(uitv/ians) - 1.13% (12)
and - 1.13% (12)
sport - 1.04% (11)
trump - 0.94% (10)
new - 0.85% (9)
world - 0.85% (9)
her - 0.85% (9)
are - 0.75% (8)
music - 0.75% (8)
don - 0.75% (8)
donald - 0.66% (7)
sports - 0.66% (7)
news - 0.66% (7)
all - 0.57% (6)
entertainment - 0.57% (6)
out - 0.57% (6)
our - 0.57% (6)
min - 0.57% (6)
mens - 0.47% (5)
business - 0.47% (5)
one - 0.47% (5)
more - 0.47% (5)
s... - 0.47% (5)
president - 0.47% (5)
test - 0.47% (5)
women - 0.47% (5)
los - 0.47% (5)
says - 0.38% (4)
with - 0.38% (4)
accessories - 0.38% (4)
light - 0.38% (4)
clothing - 0.38% (4)
private - 0.38% (4)
air - 0.38% (4)
angeles, - 0.38% (4)
spa - 0.38% (4)
khan - 0.28% (3)
top - 0.28% (3)
movies - 0.28% (3)
b2b - 0.28% (3)
--> - 0.28% (3)
electronics - 0.28% (3)
liam - 0.28% (3)
furniture - 0.28% (3)
team - 0.28% (3)
shoes - 0.28% (3)
products - 0.28% (3)
indian - 0.28% (3)
view - 0.28% (3)
reserve - 0.28% (3)
womens - 0.28% (3)
just - 0.28% (3)
cricket - 0.28% (3)
red - 0.28% (3)
more... - 0.28% (3)
from - 0.28% (3)
east - 0.28% (3)
bollywood - 0.28% (3)
search - 0.28% (3)
actor - 0.28% (3)
kate - 0.28% (3)
actress - 0.28% (3)
welcome - 0.28% (3)
nav - 0.28% (3)
has - 0.28% (3)
salman - 0.28% (3)
feel - 0.28% (3)
mars - 0.28% (3)
media - 0.28% (3)
nato - 0.28% (3)
mission - 0.28% (3)
kardashian - 0.28% (3)
two - 0.28% (3)
virat - 0.28% (3)
kohli - 0.28% (3)
nasa - 0.19% (2)
dating - 0.19% (2)
culture - 0.19% (2)
asia - 0.19% (2)
a... - 0.19% (2)
lies - 0.19% (2)
intelligence - 0.19% (2)
musician - 0.19% (2)
rumours - 0.19% (2)
confirms - 0.19% (2)
sparks - 0.19% (2)
attend - 0.19% (2)
lovato's - 0.19% (2)
may - 0.19% (2)
photos - 0.19% (2)
leaked, - 0.19% (2)
summit - 0.19% (2)
'it's - 0.19% (2)
cleavage' - 0.19% (2)
hudson - 0.19% (2)
cup - 0.19% (2)
paul - 0.19% (2)
was - 0.19% (2)
kremlin - 0.19% (2)
‘confused': - 0.19% (2)
makanyi - 0.19% (2)
committee - 0.19% (2)
itc - 0.19% (2)
lodge - 0.19% (2)
qualifier - 0.19% (2)
place - 0.19% (2)
market - 0.19% (2)
listing - 0.19% (2)
british - 0.19% (2)
h... - 0.19% (2)
about - 0.19% (2)
outside - 0.19% (2)
butt - 0.19% (2)
feat. - 0.19% (2)
signs - 0.19% (2)
blac - 0.19% (2)
bill - 0.19% (2)
rihanna - 0.19% (2)
showbiz - 0.19% (2)
travel - 0.19% (2)
hotel - 0.19% (2)
royal - 0.19% (2)
lopez - 0.19% (2)
grand - 0.19% (2)
bharat - 0.19% (2)
mulia - 0.19% (2)
hamanasi - 0.19% (2)
resort - 0.19% (2)
malewane - 0.19% (2)
pushing - 0.19% (2)
crewed - 0.19% (2)
content - 0.19% (2)
can - 0.19% (2)
fan - 0.19% (2)
shot - 0.19% (2)
tom - 0.19% (2)
demi - 0.19% (2)
german - 0.19% (2)
jennifer - 0.19% (2)
quick - 0.19% (2)
export - 0.19% (2)
sport: - 0.19% (2)
lighting - 0.19% (2)
australian - 0.19% (2)
food - 0.19% (2)
denim - 0.19% (2)
made - 0.19% (2)
care - 0.19% (2)
number - 0.19% (2)
phone - 0.19% (2)
email - 0.19% (2)
name - 0.19% (2)
registration - 0.19% (2)
embarrassed, - 0.19% (2)
auto - 0.19% (2)
connect - 0.19% (2)
ashamed: - 0.19% (2)
other - 0.19% (2)
legend - 0.19% (2)
free - 0.19% (2)
join - 0.19% (2)
over - 0.19% (2)
tokyo - 0.19% (2)
magi - 0.19% (2)
khloe - 0.19% (2)
las - 0.19% (2)
creating - 0.19% (2)
form - 0.19% (2)
policy - 0.19% (2)
become - 0.19% (2)
edible - 0.19% (2)
secretary - 0.19% (2)
life - 0.19% (2)
strike - 0.19% (2)
state - 0.19% (2)
tumble - 0.19% (2)
turkey - 0.19% (2)
seoul - 0.19% (2)
spokes - 0.19% (2)
khan, - 0.19% (2)
katrina - 0.19% (2)
kaif - 0.19% (2)
diaspora - 0.19% (2)
c... - 0.19% (2)
'back - 0.19% (2)
men's - 0.19% (2)
kids - 0.19% (2)
oils - 0.19% (2)
baby - 0.19% (2)
se... - 0.19% (2)
girls - 0.19% (2)
roly - 0.19% (2)
home - 0.19% (2)
sofa - 0.19% (2)
regional - 0.19% (2)
bat - 0.19% (2)
together' - 0.19% (2)
tiger - 0.19% (2)
zinda - 0.19% (2)
dark - 0.19% (2)
b2c - 0.19% (2)
cmt - 0.19% (2)
parliament - 0.19% (2)
march 22 - 1.23% (13)
22 (uitv/ians) - 1.13% (12)
(uitv/ians) - - 1.13% (12)
donald trump - 0.66% (7)
us president - 0.47% (5)
angeles, march - 0.38% (4)
president donald - 0.38% (4)
mens clothing - 0.38% (4)
los angeles, - 0.38% (4)
welcome to - 0.28% (3)
virat kohli - 0.28% (3)
world news - 0.19% (2)
just cleavage' - 0.19% (2)
says 'it's - 0.19% (2)
leaked, actress - 0.19% (2)
private photos - 0.19% (2)
demi lovato's - 0.19% (2)
katrina kaif - 0.19% (2)
jennifer lopez - 0.19% (2)
music sports - 0.19% (2)
baby & - 0.19% (2)
roly girls - 0.19% (2)
& furniture - 0.19% (2)
furniture l - 0.19% (2)
salman khan, - 0.19% (2)
hudson sparks - 0.19% (2)
'back together' - 0.19% (2)
trump of - 0.19% (2)
world cup - 0.19% (2)
rumours with - 0.19% (2)
sparks dating - 0.19% (2)
kate hudson - 0.19% (2)
australian media - 0.19% (2)
world sport: - 0.19% (2)
the donald - 0.19% (2)
in tiger - 0.19% (2)
has become - 0.19% (2)
royal malewane - 0.19% (2)
itc grand - 0.19% (2)
grand bharat - 0.19% (2)
with musician - 0.19% (2)
dating rumours - 0.19% (2)
sports & - 0.19% (2)
home & - 0.19% (2)
name * - 0.19% (2)
& shoes - 0.19% (2)
us intelligence - 0.19% (2)
kaif 'back - 0.19% (2)
khan, katrina - 0.19% (2)
in may - 0.19% (2)
nato summit - 0.19% (2)
to attend - 0.19% (2)
‘confused': kremlin - 0.19% (2)
committee is - 0.19% (2)
to mars - 0.19% (2)
tiger zinda - 0.19% (2)
nasa mission - 0.19% (2)
for crewed - 0.19% (2)
bill pushing - 0.19% (2)
trump signs - 0.19% (2)
parliament us - 0.19% (2)
outside british - 0.19% (2)
two shot - 0.19% (2)
together' in - 0.19% (2)
kohli has - 0.19% (2)
phone number - 0.19% (2)
* email - 0.19% (2)
email * - 0.19% (2)
regional indian - 0.19% (2)
quick registration - 0.19% (2)
view more - 0.19% (2)
edible oils - 0.19% (2)
number * - 0.19% (2)
* phone - 0.19% (2)
registration name - 0.19% (2)
become the - 0.19% (2)
us for - 0.19% (2)
trump policy - 0.19% (2)
ashamed: khloe - 0.19% (2)
feel embarrassed, - 0.19% (2)
made me - 0.19% (2)
sport: australian - 0.19% (2)
of world - 0.19% (2)
listing b2b - 0.19% (2)
22 (uitv/ians) - - 1.13% (12)
march 22 (uitv/ians) - 1.13% (12)
los angeles, march - 0.38% (4)
president donald trump - 0.38% (4)
shot outside british - 0.19% (2)
lovato's private photos - 0.19% (2)
for crewed nasa - 0.19% (2)
mission to mars - 0.19% (2)
us intelligence committee - 0.19% (2)
is ‘confused': kremlin - 0.19% (2)
'it's just cleavage' - 0.19% (2)
leaked, actress says - 0.19% (2)
hudson sparks dating - 0.19% (2)
rumours with musician - 0.19% (2)
private photos leaked, - 0.19% (2)
actress says 'it's - 0.19% (2)
kohli has become - 0.19% (2)
the donald trump - 0.19% (2)
signs bill pushing - 0.19% (2)
british parliament us - 0.19% (2)
parliament us president - 0.19% (2)
kaif 'back together' - 0.19% (2)
donald trump signs - 0.19% (2)
bill pushing for - 0.19% (2)
crewed nasa mission - 0.19% (2)
intelligence committee is - 0.19% (2)
donald trump to - 0.19% (2)
attend nato summit - 0.19% (2)
salman khan, katrina - 0.19% (2)
in tiger zinda - 0.19% (2)
two shot outside - 0.19% (2)
has become the - 0.19% (2)
donald trump of - 0.19% (2)
world sport: australian - 0.19% (2)
me feel embarrassed, - 0.19% (2)
ashamed: khloe kardashian - 0.19% (2)
name * email - 0.19% (2)
* phone number - 0.19% (2)
baby & kids - 0.19% (2)
of world sport: - 0.19% (2)

Here you can find chart of all your popular one, two and three word phrases. Google and others search engines means your page is about words you use frequently.

Copyright © 2015-2016 hupso.pl. All rights reserved. FB | +G | Twitter

Hupso.pl jest serwisem internetowym, w którym jednym kliknieciem możesz szybko i łatwo sprawdź stronę www pod kątem SEO. Oferujemy darmowe pozycjonowanie stron internetowych oraz wycena domen i stron internetowych. Prowadzimy ranking polskich stron internetowych oraz ranking stron alexa.