1.00 score from hupso.pl for:
timesofindia.com



HTML Content


Titleindia news, latest sports, bollywood, world, business & politics news - times of india

Length: 90, Words: 14
Description times of india brings the latest news & top breaking headlines on politics and current affairs in india & around the world, sports, business, bollywood news and entertainment, science, technology, health & fitness news, cricket & opinions from leading columnists.

Length: 279, Words: 40
Keywords timesofindia,news,latest news,cricket news,indian news,daily news,live news,toi,business news,news in india,online news,times news,bollywood news,breaking news,current news,india newspaper,today news,world news,mumbai news,sports news,delhi news,india latest news,recent news,local news,news headlines,news site,news website,news india,latest cricket news,top news,india news,entertainment news,national news,political news,toi news paper,times of india,news paper
Robots noodp,noydir
Charset UTF-8
Og Meta - Title exist
Og Meta - Description exist
Og Meta - Site name exist
Tytuł powinien zawierać pomiędzy 10 a 70 znaków (ze spacjami), a mniej niż 12 słów w długości.
Meta opis powinien zawierać pomiędzy 50 a 160 znaków (łącznie ze spacjami), a mniej niż 24 słów w długości.
Kodowanie znaków powinny być określone , UTF-8 jest chyba najlepszy zestaw znaków, aby przejść z powodu UTF-8 jest bardziej międzynarodowy kodowaniem.
Otwarte obiekty wykresu powinny być obecne w stronie internetowej (więcej informacji na temat protokołu OpenGraph: http://ogp.me/)

SEO Content

Words/Characters 3393
Text/HTML 8.30 %
Headings H1 1
H2 43
H3 55
H4 13
H5 47
H6 0
H1
top news stories
H2
cheap fuel, rupay card for villagers: govt announces big digital push
entertainmentjayalalithaa's last journey: updates from chennai
watch latest videos
entertainment
tech
news
reviews
latest
television highlights
world
photos/videos
most popular
navbharat times
coupons & offers
epaper: online replica of print
city
good news
life & style
featured
health
femina
beauty pageants
travel
spirituality
business
times news - radio
sports
auto
cricket
humour
real estate
citizen reporter
blogs
women
science
environment
sunday times
nri
speak out
education
access times of india news on the move!
more from our network
top trends
H3
featured today
hindi movies
hindi reviews
hindi tv
hindi music
english
events
sharmila tagore on kareena’s pregnancy
are rashami, sidharth more than just co-stars?
trump stacks top government posts with retired
live astrology
smoke from metro coach at rajendra place, train withdrawn
dhrangadhra widow performs rituals at daughter's wedding
8 pictures that redefine motherhood
7 ways you are making your breakfast cereal unhealthy
signs that you are commitment phobic
peter england mr. india 2016 webisode 1
women of these 3 zodiac signs are perfect for marriage!
govt has infused rs 23,993cr funds in ai: minister
two coaches of capital express derail, 34 injured
live blog: junior hockey world cup - india vs canada
car sales edge up in november
social humour: trump beats modi, twitter reacts
will compensate buyers if property value falls, assure
cops break traffic rules
after jayalalithaa: panneerselvam is on uncharted terrain as cm of tamil nadu
old pics of bollywood actresses
complete coverage
lonely cave dwelling bacteria resistant to 18 antibiotics
tequila plant may be key to fighting droughts
now, kids join the everest race
pio uk mp calls on india to end demonetisation stress
do you think setting kra's for students and teachers
hrd to promote digital transactions among students
zigwheels.com
off-roading review: isuzu d-max v-cross
the huffington post
business insider india
techradar india
market
learn at coursera
gizmodo india
mensxp
itimes
bigg boss' priyanka jagga's personal life!
lifehacker
jobs
7 communication tips to retain employees
indiatimes
goal
filmfare
sonakshi sinha and bunty sachdev party together
boxtv
watch echoes 2015 english movie online
follow us on
H4 follow world
follow business
follow technology
follow cricbuzz
follow sports
follow entertainment
follow life & style
follow photos
related videos
read online replica of your favourite edition of toi anywhere.
news
sensex
nifty
H5 ‘a queue to end all queues’: pm narendra modi hard-sells demonetisation in moradabad
new notes worth rs 4.7 crore seized in i-t raids in bengaluru
son has no legal right in parents' house, can stay at their mercy: delhi high court
this is what gave qamar bajwa an edge in the race for pak army chief post, according to pak media
demonetisation: unaccounted deposits to attract 50% tax, 4 year lock-in period
demonetisation tightens: no more exchange of rs 500 and rs 1000 notes, centre announces
pic: adira's birth announcement cradle filled with goodies!
rumoured 'dabangg 3' actress leaks topless pics for publicity?
pic: abram kissed by two girls!
pic: varun dhawan gearing up for underwater stunts
pics: deepika padukone back on ‘xxx’ sets
what made hrithik run behind his son hrehaan?
britain's daily mail eyeing yahoo bid: media report
sony cuts us prices for playstation 4 ahead of holiday season
attrition at top level hurting e-commerce companies in india
8 ways to go tree-less this christmas
10 banned foods across the world
swaryog rules for healthy eating
kangana unhappy with hrithik for dragging rangoli into their battle?
pic: arpita khan's maternity photoshoot
sonam kapoor speaks about her alleged love affair
over 93 percent support for demonetisation in survey on pm narendra modi's app
if saarc fails, there’s bimstec: india warns pakistan
incriminating documents, rs 12 lakh cash seized during raids on zakir naik's ngo
5 emotions and which body part they affect!
exotic twists for home gardens this winter
i am attracted to younger men. is it normal?
azad's gift for aamir will melt your hearts!
aamir khan - flashback to the future!
sanjay dutt and salman khan end their friendship?
8 uses of coffee maker no one told you
vaginal problems you should be aware of
clever ideas to dress up your house for xmas party
flipkart announces next big billion sale’s dates
what happens when iphone 6s is dipped in water
chandigarh man sells water pumps online, gets google ceo's praise
deal of the day: upto 85% off on deals every hour
flat rs. 7,000 off on apple iphone 6
offer of the day: flat 40% cashback on travel deals
coupondunia exclusive: upto rs. 1000 cashback on domestic fl
flat 25% off on your first purchase (new users only)
other times group news sites
living and entertainment
interest network
hot on the web
services
trending topics
H6
strong
in focus:
movie reviews:

b
i
in focus:
movie reviews:

em
Bolds strong 4
b 0
i 4
em 0
Zawartość strony internetowej powinno zawierać więcej niż 250 słów, z stopa tekst / kod jest wyższy niż 20%.
Pozycji używać znaczników (h1, h2, h3, ...), aby określić temat sekcji lub ustępów na stronie, ale zwykle, użyj mniej niż 6 dla każdego tagu pozycje zachować swoją stronę zwięzły.
Styl używać silnych i kursywy znaczniki podkreślić swoje słowa kluczowe swojej stronie, ale nie nadużywać (mniej niż 16 silnych tagi i 16 znaczników kursywy)

Statystyki strony

twitter:title pusty
twitter:description pusty
google+ itemprop=name exist
Pliki zewnętrzne 20
Pliki CSS 4
Pliki javascript 16
Plik należy zmniejszyć całkowite odwołanie plików (CSS + JavaScript) do 7-8 maksymalnie.

Linki wewnętrzne i zewnętrzne

Linki 1040
Linki wewnętrzne 482
Linki zewnętrzne 558
Linki bez atrybutu Title 447
Linki z atrybutem NOFOLLOW 0
Linki - Użyj atrybutu tytuł dla każdego łącza. Nofollow link jest link, który nie pozwala wyszukiwarkom boty zrealizują są odnośniki no follow. Należy zwracać uwagę na ich użytkowania

Linki wewnętrzne

more javascript:void(0);
more javascript://
more javascript://
fashion /life/fashion/articlelistls/2886715.cms
specials /life-style/relationship/specials/lsspeciallist/6247311.cms
debate /debatelist/3133631.cms
videos /videos/lifestyle/videolist/3813443.cms
platinum /eternalplat_home.cms
times of india /
more javascript:void(0);
homehome /
city /city
mumbai /city/mumbai
delhi /city/delhi
bangalore /city/bangalore
hyderabad /city/hyderabad
kolkata /city/kolkata
chennai /city/chennai
agartala /city/agartala
agra /city/agra
ahmedabad /city/ahmedabad
allahabad /city/allahabad
amritsar /city/amritsar
aurangabad /city/aurangabad
bareilly /city/bareilly
bhopal /city/bhopal
bhubaneswar /city/bhubaneswar
chandigarh /city/chandigarh
coimbatore /city/coimbatore
cuttack /city/cuttack
dehradun /city/dehradun
erode /city/erode
faridabad /city/faridabad
goa /city/goa
gurgaon /city/gurgaon
guwahati /city/guwahati
hubli /city/hubli
imphal /city/imphal/articlelist/48264476.cms
indore /city/indore
jaipur /city/jaipur
jammu /city/jammu
jamshedpur /city/jamshedpur
jind /city/jind
kanpur /city/kanpur
kochi /city/kochi
kolhapur /city/kolhapur
kozhikode /city/kozhikode
lucknow /city/lucknow
ludhiana /city/ludhiana
madurai /city/madurai
mangalore /city/mangalore
meerut /city/meerut/articlelist/36768500.cms
mysore /city/mysore
nagpur /city/nagpur
nashik /city/nashik
navi mumbai /city/navi-mumbai
noida /city/noida
patna /city/patna
puducherry /city/puducherry
pune /city/pune
raipur /city/raipur
rajahmundry /city/rajahmundry
rajkot /city/rajkot
ranchi /city/ranchi
srinagar /city/srinagar
salem /city/salem
shillong /city/shillong
shimla /city/shimla
surat /city/surat
thane /city/thane
trichy /city/trichy
thiruvananthapuram /city/thiruvananthapuram
vadodara /city/vadodara
varanasi /city/varanasi
visakhapatnam /city/visakhapatnam
india /india
world /world
world /world
us /world/us
pakistan /world/pakistan
south asia /world/south-asia
uk /world/uk
europe /world/europe
china /world/china
middle east /world/middle-east
new to canada /world/new_to_canada.cms
rest of world /world/rest-of-world
mad, mad world /world/mad-mad-world
videos /videos/news
business /business
business /business
india business /business/india-business
international business /business/international-business
videos /videos/business
sports /sports
sports /sports
ipl /sports/ipl-2015/sphome/46780979.cms
football /sports/football
tennis /sports/tennis
hockey /sports/hockey
golf /sports/golf
racing /sports/racing
nba /sports/nba
sfl /sports/sfl
badminton /sports/badminton
boxing /sports/boxing/articlelist/3413166.cms
chess /sports/chess/articlelist/5802554.cms
south africa in india /sports/new-zealand-in-india/top-stories/articlelist/4719919.cms
more sports /sports/more-sports
videos /videos/sports
entertainment /entertainment
entertainment /entertainment
hindi /entertainment/hindi/articlelistls/27135527.cms
english /entertainment/english
tamil /entertainment/tamil
telugu /entertainment/telugu
malayalam /entertainment/malayalam
kannada /entertainment/kannada
bengali /entertainment/bengali
punjabi /entertainment/punjabi
marathi /entertainment/marathi
bhojpuri /entertainment/bhojpuri
gujarati /entertainment/gujarati
movie reviews /entertainment/movie-reviews
music /entertainment/music/articlelistls/27976150.cms
videos /videos/entertainment
tv /tv/hindi/tvhome/17781976.cms?utm_source=toihp
tv news /tv/hindi/tvhome/17781976.cms?utm_source=toihp
news /tv/news/hindi/tvarticlelist/2278290.cms?utm_source=toihp
trade news /tv/trade-news/hindi/tvarticlelist/37699503.cms?utm_source=toihp
tv listings /tv/tvlistings
movies on tv /tv/tvmoviefinder.cms
specials /tv/hindi/tvspecial/36764109.cms
videos /videos/tv/videolist/49150189.cms
hindi /tv/hindi/tvhome/17781976.cms
english /tv/english/tvhome/45457568.cms
tamil /tv/tamil/tvhome/45457467.cms
telugu /tv/telugu/tvhome/45457315.cms
malayalam /tv/malayalam/tvhome/45457304.cms
kannada /tv/kannada/tvhome/45457295.cms
marathi /tv/marathi/tvhome/45457283.cms
bengali /tv/bengali/tvhome/45457278.cms
gujarati /tv/gujarati/tvhome/45471480.cms
life & style /life-style/articlelistls/2886704.cms
life & style /life-style/articlelistls/2886704.cms
relationships /life-style/relationships/articlelistls/2886713.cms
health & fitness /life-style/health-fitness/storylist/2886714.cms
listen to your sugar /life-style/listen-to-your-sugar/storylist/50769745.cms
beauty /life-style/beauty/articlelist/2886724.cms
spotlight /life-style/spotlight/articlelist/4141042.cms
food /life-style/food/articlelistls/2886710.cms
books /life-style/books/storylist/48956926.cms
home & garden /life-style/home-garden/articlelist/5912641.cms
fashion /life/fashion/articlelistls/2886715.cms
every heart counts /life-style/health-fitness/every-heart-counts/storylist/43417225.cms
homeopathy /life-style/health-fitness/homeopathy/homeopathylist/54458707.cms
videos /videos/lifestyle/videolist/3813443.cms
all sections javascript:void(0)
all javascript:void(0)
- /india/after-one-month-of-demonetisation-fm-arun-jaitley-announces-slew-of-measures-to-promote-digital-payments/articleshow/55875898.cms
cheap fuel, rupay card for villagers: govt announces big digital push /india/after-one-month-of-demonetisation-fm-arun-jaitley-announces-slew-of-measures-to-promote-digital-payments/articleshow/55875898.cms
rs 90cr cash, 100kg gold seized from chennai jewellers /city/chennai/rs-90-crore-in-cash-100kg-of-gold-seized-in-i-t-raids-at-8-locations-in-chennai/articleshow/55874398.cms
/city/chennai/rs-90-crore-in-cash-100kg-of-gold-seized-in-i-t-raids-at-8-locations-in-chennai/articleshow/55874398.cms
pakistan plane crash: pia blames engine failure /world/pakistan/pakistan-plane-crash-pia-blames-engine-failure/articleshow/55876589.cms
for god's sake, do your job: president to mps /india/pranab-mukherjee-blasts-a-disrupted-parliament-for-gods-sake-do-your-job/articleshow/55873184.cms
/india/pranab-mukherjee-blasts-a-disrupted-parliament-for-gods-sake-do-your-job/articleshow/55873184.cms
4th test: india hit back after jennings century /sports/cricket/england-in-india-2016/india-v-england-4th-test-india-hit-back-with-late-strikes-after-jennings-ton/articleshow/55869257.cms
anti-left mamata slams govt for being 'capitalist' /india/famously-anti-left-mamata-banerjee-slams-bjp-government-for-becoming-more-and-more-capitalist/articleshow/55873988.cms
/india/famously-anti-left-mamata-banerjee-slams-bjp-government-for-becoming-more-and-more-capitalist/articleshow/55873988.cms
jayalalithaa's last journey: updates from chennai /tamil-nadu-cm-jayalalithaa-passes-away-after-a-cardiac-arrest/liveblog/55796067.cms
sharmila tagore on kareena's pregnancy /entertainment/hindi/bollywood/news/this-is-what-sharmila-tagore-has-to-say-about-daughter-in-law-kareenas-pregnancy/articleshow/55874831.cms
movie review: la la land /entertainment/english/movie-reviews/la-la-land/movie-review/55873699.cms
/entertainment/english/movie-reviews/la-la-land/movie-review/55873699.cms
watch: sanjay-maanayata return from dubai /entertainment/english/hollywood/news/watch-sanjay-and-maanayata-dutt-return-from-their-exotic-holiday/articleshow/55874767.cms
kjo's sweetest message for manish malhotra /entertainment/hindi/bollywood/news/watch-karan-johar-has-the-sweetest-message-for-best-friend-manish-malhotra/articleshow/55870770.cms
movie review: deepwater horizon /entertainment/english/movie-reviews/deepwater-horizon/movie-review/55867097.cms
/entertainment/english/movie-reviews/deepwater-horizon/movie-review/55867097.cms
watch: priyanka releases ‘baywatch’ teaser /entertainment/hindi/bollywood/news/watch-priyanka-chopra-teases-fans-with-sneak-peek-of-baywatch/articleshow/55865874.cms
bb10: bani will not meet lopa after the show /tv/news/hindi/bigg-boss-10-heres-why-bani-would-not-like-to-see-lopamudra-outside-the-house/articleshow/55874444.cms
aamir khan to go solo in 'koffee with karan' /tv/news/hindi/aamir-khan-to-go-solo-in-koffee-with-karan/articleshow/55874548.cms
watch latest videos /videos
tv /videos/tv
trailers /videos/trailers
entertainment /videos/entertainment
sports /videos/sports
news /videos/news
no old notes for buses, metro, rail after dec 10 /india/demonetised-rs-500-notes-wont-be-accepted-by-railways-in-buses-at-metro-stations-after-december-10/articleshow/55874364.cms
delhi govt hikes guest teachers' salary by up to 90% /city/delhi/delhi-govt-increases-salary-of-guest-teachers/articleshow/55876129.cms
talks with india should be result-oriented, says pak /india/talks-with-india-should-be-result-oriented-says-pakistan/articleshow/55873851.cms
-ruckus at jaipur art festival /videos/news/ruckus-at-jaipur-art-festival/videoshow/55874820.cms
-fire at patel nagar metro station /videos/news/fire-breaks-out-at-patel-nagar-metro-station-passengers-safely-evacuated/videoshow/55875276.cms
-note ban will empower the poor: pm /videos/news/note-ban-will-empower-the-poor-and-benefit-future-generations-pm-modi/videoshow/55871998.cms
eu launches legal case in volkswagen scandal case /world/europe/european-union-launches-legal-case-against-germany-uk-over-volkswagen-scandal/articleshow/55874322.cms
note ban: a month on, cash-crunch still continues /india/note-ban-a-month-on-cash-crunch-still-continues/articleshow/55874510.cms
three lashkar militants killed in kashmir gunfight /india/three-lashkar-militants-killed-in-kashmir-gunfight/articleshow/55874054.cms
sensex zooms 457 points, nifty tops 8,200 /business/india-business/sensex-zooms-457-points-nifty-tops-8200-on-global-rally/articleshow/55875205.cms
/business/india-business/sensex-zooms-457-points-nifty-tops-8200-on-global-rally/articleshow/55875205.cms
how to bring 500kg woman to mumbai for surgery /city/mumbai/how-to-bring-500kg-woman-to-mumbai-for-operation/articleshow/55868424.cms
has trump softened his stand on h1-b visas? /india/has-us-president-elect-donald-trump-softened-his-stand-on-h1-b-visas/articleshow/55873405.cms
no churidar at padmanabhaswamy temple: hc /india/no-churidar-at-padmanabhaswamy-temple-hc/articleshow/55871973.cms
/india/no-churidar-at-padmanabhaswamy-temple-hc/articleshow/55871973.cms
world bank cancels $100 million loan for pakistan /world/pakistan/world-bank-cancels-100-million-loan-for-pakistan/articleshow/55873422.cms
this 'supersonic' train may be faster than flight /city/bengaluru/this-train-can-beat-a-flight/articleshow/55865739.cms
the real inside story of tata - mistry breakup /business/india-business/the-real-inside-story-of-the-ratan-tata-cyrus-mistry-breakup/articleshow/55865720.cms
note ban a 'yagna' against graft: pm modi /india/pm-defends-demonetisation-now-says-it-will-help-farmers-labourers/articleshow/55871790.cms
/india/pm-defends-demonetisation-now-says-it-will-help-farmers-labourers/articleshow/55871790.cms
hyderabad techies provide support to chennaites /city/hyderabad/hyderabad-techies-back-up-on-for-chennai-servers/articleshow/55865174.cms
no service tax on card transactions up to rs 2,000 /business/india-business/govt-to-waive-service-tax-on-card-transactions-up-to-rs-2000/articleshow/55870102.cms
reasons why you should drink coffee everyday /life-style/health-fitness/diet/reasons-why-you-should-drink-coffee-everyday/photostory/55869762.cms
jhanvi kapoor is the new golden girl of bollywood /life-style/fashion/celeb-style/jhanvi-kapoor-is-the-new-golden-girl-of-bollywood-heres-proof/articleshow/55872675.cms
british waxworks get christmas makeover! /life-style/home-garden/british-waxworks-get-christmas-makeover/articleshow/55870703.cms
8 ways to perk up your mood /life-style/health-fitness/de-stress/8-ways-to-perk-up-your-mood/articleshow/55598053.cms
-5 fears that diabetics have /life-style/health-fitness/health-news/5-biggest-fears-that-diabetics-have/articleshow/55368539.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-should you refrigerate eggs? /life-style/food/food-features/should-you-refrigerate-eggs/articleshow/55854829.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-nail art for christmas time /life-style/beauty/christmas-nail-art/articleshow/55524939.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-tips to boost winter immunity /life-style/health-fitness/fitness/build-your-immunity-for-winter/articleshow/55854850.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-friends to keep away from your man /life-style/relationships/love-sex/friends-you-dont-want-your-partner-to-meet/articleshow/55854183.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-exotic twists for home gardens /life-style/home-garden/joy-of-gardening-in-winters/articleshow/55811708.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
hindi movies /entertainment/hindi/bollywood/articlelistls/4724967.cms
-this actress wants to take acting tips from kangana ranaut /entertainment/hindi/bollywood/news/this-actress-wants-to-take-acting-tips-from-kangana-ranaut/articleshow/55868965.cms
meghna gulzar's next based on an espionage thriller /entertainment/hindi/bollywood/news/meghna-gulzars-next-based-on-an-espionage-thriller-about-a-kashmiri-girl-married-to-a-pakistani-army-officer/articleshow/55866802.cms
karan johar: everything said by celebs shouldn't be /entertainment/hindi/bollywood/news/karan-johar-everything-said-by-celebs-shouldnt-be-over-analysed/articleshow/55849265.cms
‘kahaani 2’ box-office collection day 5 /entertainment/hindi/bollywood/box-office/kahaani-2-box-office-collection-day-5-vidya-balan-film-continues-its-downward-spiral/articleshow/55853479.cms
anushka: i know what soldiers go through /entertainment/hindi/bollywood/news/anushka-sharma-i-know-what-soldiers-or-their-families-go-through/articleshow/55849204.cms
hindi reviews /entertainment/hindi/movie-reviews/moviereviewarticlelist/2742919.cms
aasra movie review entertainment/hindi/movie-reviews/aasra/movie-review/55754077.cms
kahaani 2: durga rani singh movie review entertainment/hindi/movie-reviews/kahaani-2-durga-rani-singh/movie-review/55724399.cms
moh maya money movie review entertainment/hindi/movie-reviews/moh-maya-money/movie-review/55592825.cms
hindi tv /tv/hindi/tvhome/17781976.cms
-aamir khan to go solo in 'koffee with karan' /tv/news/hindi/aamir-khan-to-go-solo-in-koffee-with-karan/articleshow/55874548.cms
ye hai mohabbatein update: mani gets to know about /tv/news/hindi/ye-hai-mohabbatein-update-mani-gets-to-know-about-shaguns-fling-with-vidyut/articleshow/55874268.cms
watch trailer: ducktales is coming back to your tv /tv/news/hindi/watch-trailer-ducktales-is-coming-back-to-your-tv-screens/articleshow/55873512.cms
amrita puri's personal connection with her reel /tv/news/hindi/amrita-puris-personal-connection-with-her-reel-avatar/articleshow/55872908.cms
ranveer singh refuses to appear on comedy nights /tv/news/hindi/ranveer-singh-is-not-ready-for-another-roast-refuses-to-appear-on-comedy-nights-bachao-tazza/articleshow/55872497.cms
hindi music /entertainment/hindi/music/articlelistls/6691347.cms
himesh reshammiya files for divorce from /entertainment/hindi/music/news/himesh-reshammiya-files-for-divorce-from-wife-of-22-years/articleshow/55849989.cms
anoushka shankar's refugee album vies for /entertainment/hindi/music/news/anoushka-shankars-refugee-album-vies-for-grammy/articleshow/55853353.cms
maharashtra government assures action in /entertainment/hindi/music/news/maha-assures-action-in-hefty-power-bill-claim-by-asha-bhosale/articleshow/55836973.cms
english /entertainment/english
-jimmy kimmel to host oscars 2017 /entertainment/english/hollywood/news/jimmy-kimmel-to-host-oscars-2017/articleshow/55853467.cms
angelina jolie wants children to remain close to /entertainment/english/hollywood/news/angelina-jolie-wants-children-to-remain-close-to-brad-pitt/articleshow/55854235.cms
reese witherspoon not allowed to talk to her son /entertainment/english/hollywood/news/reese-witherspoon-not-allowed-to-talk-to-son-before-8am/articleshow/55853325.cms
margaret whitton passes away at 67 /entertainment/english/hollywood/news/margaret-whitton-passes-away-at-67/articleshow/55833090.cms
brad pitt, angelina jolie reach temporary custody /entertainment/english/hollywood/news/brad-pitt-angelina-jolie-reach-temporary-custody-agreement/articleshow/55833261.cms
'fantastic beasts' tops foreign box office with /entertainment/english/hollywood/news/fantastic-beasts-tops-foreign-box-office-with-hefty-60-4m/articleshow/55808518.cms
la la land movie review /entertainment/english/movie-reviews/la-la-land/movie-review/55873699.cms
deepwater horizon movie review /entertainment/english/movie-reviews/deepwater-horizon/movie-review/55867097.cms
events /entertainment/events
australian magician adam mada performs in /entertainment/events/delhi/a-magical-evening-with-adam-mada/articleshow/55837911.cms
k rosaiah, allu aravind attend dr srikant /entertainment/events/hyderabad/doctors-got-hitched-in-a-dreamy-ceremony/articleshow/55811595.cms
the team of 'kahaani 2' hosts a private /entertainment/events/mumbai/the-team-of-kahaani-2-hosts-a-private-screening/articleshow/55752976.cms
- /entertainment/hindi/bollywood/news/this-is-what-sharmila-tagore-has-to-say-about-daughter-in-law-kareenas-pregnancy/articleshow/55874831.cms
sharmila tagore on kareena’s pregnancy /entertainment/hindi/bollywood/news/this-is-what-sharmila-tagore-has-to-say-about-daughter-in-law-kareenas-pregnancy/articleshow/55874831.cms
watch: sanjay-maanayata return from dubai /entertainment/english/hollywood/news/watch-sanjay-and-maanayata-dutt-return-from-their-exotic-holiday/articleshow/55874767.cms
watch: kjo's sweetest message for manish malhotra /entertainment/hindi/bollywood/news/watch-karan-johar-has-the-sweetest-message-for-best-friend-manish-malhotra/articleshow/55870770.cms
baadshaho: ajay devgn announces release date /entertainment/hindi/bollywood/news/ajay-devgn-announces-the-release-date-of-baadshaho-with-a-philosophical-message/articleshow/55871887.cms
pics: virender sehwag, harbhajan singh at yuvraj /entertainment/hindi/bollywood/news/pics-virender-sehwag-harbhajan-singh-at-yuvraj-singh-hazel-keechs-wedding-reception/articleshow/55870027.cms
movie review: deepwater horizon /entertainment/english/movie-reviews/deepwater-horizon/movie-review/55867097.cms
pics: amitabh bachchan gets nostalgic on /entertainment/hindi/bollywood/news/pics-amitabh-bachchan-gets-nostalgic-on-dharmendras-birthday/articleshow/55869816.cms
katrina kaif looks mesmerising in this underwater /entertainment/hindi/bollywood/news/katrina-kaif-looks-mesmerising-in-this-underwater-picture/articleshow/55866889.cms
watch: priyanka chopra teases fans with sneak peek /entertainment/hindi/bollywood/news/watch-priyanka-chopra-teases-fans-with-sneak-peek-of-baywatch/articleshow/55865874.cms
ranveer singh wants to get married and start a /entertainment/hindi/bollywood/news/ranveer-singh-wants-to-get-married-and-start-a-family/articleshow/55866678.cms
hrithik roshan and yami gautam's song ‘kaabil hoon’ /entertainment/hindi/music/news/hrithik-roshan-and-yami-gautams-song-kaabil-hoon-out/articleshow/55866269.cms
more » /tv/hindi?utm_source=toihp
television highlights /tv/hindi?utm_source=toihp
more » /world
world /world
- /world/us/trump-stacks-top-government-posts-with-retired-generals/articleshow/55874371.cms
trump stacks top government posts with retired /world/us/trump-stacks-top-government-posts-with-retired-generals/articleshow/55874371.cms
kerry warns europe against 'authoritarian populism' /world/europe/kerry-warns-europe-against-authoritarian-populism/articleshow/55874905.cms
manila says will not help us on patrols in south /world/rest-of-world/manila-says-will-not-help-us-on-patrols-in-south-china-seas/articleshow/55871755.cms
probe launched into pak plane crash that killed 48 /world/pakistan/probe-launched-into-pakistan-plane-crash-that-claimed-48-lives/articleshow/55871319.cms
trump picks 'old friend' of xi as us envoy to china /us-elections-2016/donald-trump-picks-old-friend-of-president-xi-jinping-as-us-envoy-to-china/articleshow/55870805.cms
videos
photos
trending
news
entertainment
celebs
movie
lifestyle
sports
tech
business
auto
funny
most popular
movies
celebs
fashion
parties
awards
events
sports
gadgets
news
things you didn't know about jayalalithaa /videos/news/things-you-didnt-know-about-jayalalithaa/videoshow/55828556.cms
a timeline of jayalalithaa's life in film and politics /videos/news/a-timeline-of-jayalalithaas-life-in-film-and-politics/videoshow/55827158.cms
actor rajinikanth, dhanush pay homage to jayalalithaa /videos/news/actor-rajinikanth-dhanush-pay-homage-to-jayalalithaa/videoshow/55829836.cms
deepika slays the no make-up look in this latest picture /videos/celebs/deepika-slays-the-no-make-up-look-in-this-latest-picture/videoshow/55787263.cms
dharmendra remembers co-star jayalalithaa /videos/news/dharmendra-remembers-co-star-jayalalithaa/videoshow/55826988.cms
sana khan wanted intimate scenes to be okayed in one take /videos/entertainment/hindi/sana-khan-wanted-intimate-scenes-to-be-okayed-in-one-take/videoshow/55788880.cms
nation mourns jayalalithaa's demise /videos/news/nation-mourns-jayalalithaas-demise/videoshow/55826225.cms
rock on 2 poster: farhan akhtar, arjun rampal return with shraddha kapoor /videos/movies/hindi/rock-on-2-poster-farhan-akhtar-arjun-rampal-return-with-shraddha-kapoor/videoshow/53983057.cms
watch: jayalalithaa's final journey /videos/news/jayalalithaas-final-journey-begins/videoshow/55835040.cms
aiadmk workers mourn the passing away of jayalalithaa /videos/news/aiadmk-workers-mourn-the-passing-away-of-jayalalithaa/videoshow/55823171.cms
#
#
#
#
most shared
most read
most commented
amma no more: tamil nadu chief minister jayalalithaa dies /city/chennai/amma-no-more-tamil-nadu-chief-minister-jayalalithaa-dies/articleshow/55822315.cms
likely for 'mothership of terror' comment, pm narendra modi beats donald trump, others in time's online 'person of the year' poll /india/likely-for-mothership-of-terror-comment-pm-narendra-modi-beats-donald-trump-others-in-times-online-person-of-the-year-poll/articleshow/55806689.cms
jayalalithaa: an icon's life in pictures /jayalalithaa-an-icons-life-in-pictures/articleshow/55818011.cms
virat kohli’s post supporting anushka sharma declared the ‘golden tweet’ of 2016 /entertainment/hindi/bollywood/news/virat-kohlis-post-supporting-anushka-sharma-declared-the-golden-tweet-of-2016/articleshow/55848486.cms
see all most shared stories /mostshared.cms
see all most read stories /mostread.cms
see all most commented stories /mostcommented.cms
- /britains-daily-mail-eyeing-yahoo-bid-media-report/articleshow/51779421.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
britain's daily mail eyeing yahoo bid: media report /britains-daily-mail-eyeing-yahoo-bid-media-report/articleshow/51779421.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- /sony-cuts-us-prices-for-playstation-4-ahead-of-holiday-season/articleshow/49271786.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
sony cuts us prices for playstation 4 ahead of holiday season /sony-cuts-us-prices-for-playstation-4-ahead-of-holiday-season/articleshow/49271786.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- /life-style/home-garden/8-ways-to-go-tree-less-this-christmas/photostory/55787922.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
8 ways to go tree-less this christmas /life-style/home-garden/8-ways-to-go-tree-less-this-christmas/photostory/55787922.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- /life-style/food/food-features/swaryog-rules-for-healthy-eating/articleshow/55726724.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
swaryog rules for healthy eating /life-style/food/food-features/swaryog-rules-for-healthy-eating/articleshow/55726724.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- /life-style/health-fitness/health-news/5-emotions-and-which-body-part-they-affect/photostory/55808845.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
5 emotions and which body part they affect! /life-style/health-fitness/health-news/5-emotions-and-which-body-part-they-affect/photostory/55808845.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- /life-style/home-garden/joy-of-gardening-in-winters/articleshow/55811708.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
exotic twists for home gardens this winter /life-style/home-garden/joy-of-gardening-in-winters/articleshow/55811708.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- /life-style/relationships/ask-the-expert/i-am-attracted-to-younger-men-is-it-normal/articleshow/46584306.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
i am attracted to younger men. is it normal? /life-style/relationships/ask-the-expert/i-am-attracted-to-younger-men-is-it-normal/articleshow/46584306.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- /life-style/health-fitness/health-news/vaginal-problems-you-should-be-aware-of/photostory/55767928.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
vaginal problems you should be aware of /life-style/health-fitness/health-news/vaginal-problems-you-should-be-aware-of/photostory/55767928.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- /life-style/home-garden/clever-ideas-to-dress-up-your-house-for-christmas-party/photostory/55751653.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
clever ideas to dress up your house for xmas party /life-style/home-garden/clever-ideas-to-dress-up-your-house-for-christmas-party/photostory/55751653.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
intex aqua shine 4g /techgadgets/intex/aquashine4g/52433428
motorola moto g4 plus /techgadgets/motorola/motog4plus/52309218
intex cloud fame /techgadgets/intex/cloudfame/52192177
samsung galaxy j7 (2016) /techgadgets/samsung/galaxyj72016/52185597
zte v7 /techgadgets/zte/v7/51940655
acer liquid zest plus /techgadgets/acer/liquidzestplus/51939719
intex aqua g2 /techgadgets/intex/aquag2/51908441
asus zenfone go 4.5 2nd gen /techgadgets/asus/zenfonego452ndgen/51977179
phicomm clue 630 /techgadgets/phicomm/clue630/51775979
huawei p9 /techgadgets/huawei/p9/51726481
how rich are you? /calculator.cms
obituaries / tributes /tributelist.cms
mobile 58888
nri solutions
more » /city
city /city
- /city/delhi/smoke-from-metro-coach-at-rajendra-place-metro-station-train-withdrawn/articleshow/55876881.cms
smoke from metro coach at rajendra place, train withdrawn /city/delhi/smoke-from-metro-coach-at-rajendra-place-metro-station-train-withdrawn/articleshow/55876881.cms
delhi govt increases salary of guest teachers /city/delhi/delhi-govt-increases-salary-of-guest-teachers/articleshow/55876129.cms
three decades after crime, postman to go to prison /city/ahmedabad/three-decades-after-crime-postman-to-go-to-prison/articleshow/55861724.cms
lost mother for second time, rues gymnast saved by /city/kolkata/lost-mother-for-second-time-rues-gymnast-saved-by-amma/articleshow/55861834.cms
pali's bangar hospital set to go digital, 'will serve as /city/jaipur/palis-bangar-hospital-set-to-go-digital-will-serve-as-a-model-for-the-country/articleshow/55865036.cms
more » /good-news/goodnews.cms
good news /good-news/goodnews.cms
- /city/ahmedabad/dhrangadhra-widow-performs-rituals-at-daughters-wedding/articleshow/55864806.cms
dhrangadhra widow performs rituals at daughter's wedding /city/ahmedabad/dhrangadhra-widow-performs-rituals-at-daughters-wedding/articleshow/55864806.cms
air will now act as ‘navigator’ across 13 highway /india/air-will-now-act-as-navigator-across-13-highway-corridors/articleshow/55864355.cms
soon, there may be no booze shops on highways /india/soon-there-may-be-no-booze-shops-on-highways/articleshow/55863244.cms
country-wide, varsities to go cashless /india/universities-across-the-country-to-go-cashless-with-ugc-funds/articleshow/55844503.cms
life & style /life-style
more » /lifestyle/articlelistls/2886704.cms
featured /lifestyle/articlelistls/2886704.cms
he only talks about sex. help /life-style/relationships/ask-the-expert/he-only-talks-about-sex-help/articleshow/48170292.cms
egg alert! try these tests at home to find if your egg is /life-style/health-fitness/diet/egg-alert-try-these-tests-at-home-to-find-if-your-egg-is-bad/photostory/55868665.cms
british waxworks get christmas makeover! /life-style/home-garden/british-waxworks-get-christmas-makeover/articleshow/55870703.cms
jhanvi kapoor is the new golden girl of bollywood, here's /life-style/fashion/celeb-style/jhanvi-kapoor-is-the-new-golden-girl-of-bollywood-heres-proof/articleshow/55872675.cms
more » /life-style/health-fitness/storylist/2886714.cms
health /life-style/health-fitness/storylist/2886714.cms
- /life-style/health-fitness/diet/7-ways-you-are-making-your-breakfast-cereal-unhealthy/photostory/55833726.cms
7 ways you are making your breakfast cereal unhealthy /life-style/health-fitness/diet/7-ways-you-are-making-your-breakfast-cereal-unhealthy/photostory/55833726.cms
have you ever accidentally peed while laughing? /life-style/health-fitness/health-news/have-you-ever-accidentally-peed-while-laughing/photostory/55830840.cms
winter-proof your workout /life-style/health-fitness/fitness/winter-proof-your-workout/articleshow/55810413.cms
myths about pubic hair you don't have to believe /life-style/health-fitness/health-news/myths-about-pubic-hair-you-don't-have-to-believe/photostory/55722622.cms
foods to help you overcome acidity /life-style/health-fitness/diet/foods-to-help-you-overcome-acidity/photostory/55720183.cms
more » /business
business /business
- /business/india-business/government-has-infused-rs-23993-crore-funds-in-air-india-minister/articleshow/55876976.cms
govt has infused rs 23,993cr funds in ai: minister /business/india-business/government-has-infused-rs-23993-crore-funds-in-air-india-minister/articleshow/55876976.cms
rupee nears 1-month high, soars 27p to 67.36 /business/india-business/rupee-nears-1-month-high-soars-27-paise-to-67-36/articleshow/55876952.cms
rbi may cut rates by up to 50 bps next year: report /business/india-business/rbi-may-cut-rates-by-up-to-50-bps-next-year-report/articleshow/55872692.cms
no service tax on card transactions up to rs 2,000 /business/india-business/govt-to-waive-service-tax-on-card-transactions-up-to-rs-2000/articleshow/55870102.cms
sensex rebounds 300 points, nifty above 8,200 /business/india-business/sensex-rebounds-300-points-nifty-above-8200/articleshow/55867373.cms
more » /sports
sports /sports
4th test: india hit back after jennings century /sports/cricket/england-in-india-2016/india-v-england-4th-test-india-hit-back-with-late-strikes-after-jennings-ton/articleshow/55869257.cms
sachin tendulkar picks up stake in pbl franchise /sports/badminton/sachin-tendulkar-picks-up-stake-in-pbl-franchise/articleshow/55876709.cms
talking points: reiffel cops a blow & cook's opening /sports/cricket/england-in-india-2016/india-v-england-talking-points-4th-test-mumbai-reiffel-cops-a-blow-and-cooks-opening-xi/articleshow/55875396.cms
kashyap reaches quarter-finals at korea masters /sports/badminton/kashyap-reaches-quarter-finals-at-korea-masters/articleshow/55873788.cms
more » /auto/49896634.cms
auto /auto/49896634.cms
- /auto/miscellaneous/car-sales-edge-up-in-november-passenger-vehicles-up-1-82/articleshow/55872918.cms
car sales edge up in november /auto/miscellaneous/car-sales-edge-up-in-november-passenger-vehicles-up-1-82/articleshow/55872918.cms
s korea fines vw $32 mn for false advertising /auto/miscellaneous/south-korea-fines-volkswagen-32-mn-for-false-advertising/articleshow/55857137.cms
made in chennai: bmw's twin launches are 'desi' /auto/cars/bmw-launches-two-new-cars-manufactured-in-chennai/articleshow/55853167.cms
you won't believe what new merc headlights can do /auto/miscellaneous/mercedes-digital-headlights-project-street-signs-and-markings-onto-the-road-ahead/articleshow/55841447.cms
train carrying bmws derails, 97 vehicles damaged /auto/miscellaneous/train-carrying-bmws-derails-97-vehicles-damaged/articleshow/55835291.cms
more » /humour/newslisting/50680967.cms
humour /humour/newslisting/50680967.cms
man thinks he can still achieve new year resolutions /mocktale/humour-man-thinks-he-still-has-enough-time-to-achieve-his-new-year-resolutions/articleshow/55854237.cms
- /mocktale/humour-man-thinks-he-still-has-enough-time-to-achieve-his-new-year-resolutions/articleshow/55854237.cms
more » /citizen-reporter/crstories.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
citizen reporter /citizen-reporter/crstories.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- /citizen-reporter/stories/cops-break-traffic-rules/crshow/55877028.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
cops break traffic rules /citizen-reporter/stories/cops-break-traffic-rules/crshow/55877028.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
commuters face dust as pwd sits on road work /citizen-reporter/stories/commuters-face-dust-as-pwd-sits-on-road-work/crshow/55876870.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
numberplate violations are common /citizen-reporter/stories/numberplate-violations-are-common/crshow/55875685.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
dumpyard on dwarka road median /citizen-reporter/stories/dumpyard-on-dwarka-road-median/crshow/55875434.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
carelessly put manhole lids a hazard /citizen-reporter/stories/carelessly-put-manhole-lids-a-hazard/crshow/55875271.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » /infographics.cms
infographics
cartoons
- /business/india-business/how-tamil-nadu-grew-despite-jayalalithaas-freebies/articleshow/55868777.cms
how tamil nadu grew despite jayalalithaa’s freebies /business/india-business/how-tamil-nadu-grew-despite-jayalalithaas-freebies/articleshow/55868777.cms
- /india/ap-maharashtra-take-lead-in-e-wallet-initiatives/articleshow/55854876.cms
ap, maharashtra take lead in e-wallet initiatives /india/ap-maharashtra-take-lead-in-e-wallet-initiatives/articleshow/55854876.cms
- /business/india-business/indias-crude-oil-bill-is-down-50-so-consumption-has-risen-11/articleshow/55870100.cms
india’s crude oil bill is down 50%, so consumption has risen 11% /business/india-business/indias-crude-oil-bill-is-down-50-so-consumption-has-risen-11/articleshow/55870100.cms
- /business/india-business/how-demonetisation-is-beginning-to-hurt-the-economy/articleshow/55873325.cms
how demonetisation is beginning to hurt the economy /business/india-business/how-demonetisation-is-beginning-to-hurt-the-economy/articleshow/55873325.cms
-wallet /cartoons/cartoons/ninans-world/wallet/cartoonshow/55869922.cms
-trump /cartoons/cartoons/ninans-world/trump/cartoonshow/55869888.cms
-ghajini /cartoons/cartoons/ninans-world/ghajini/cartoonshow/55866713.cms
-'paneer' price in tn /cartoons/cartoons/line-of-no-control/paneer-price-in-tn/cartoonshow/55859259.cms
more » /specials/4758720.cms
more » /news/science/articlelist/-2128672765.cms
science /news/science/articlelist/-2128672765.cms
- /home/science/lonely-cave-dwelling-bacteria-resistant-to-18-antibiotics/articleshow/55876850.cms
lonely cave dwelling bacteria resistant to 18 antibiotics /home/science/lonely-cave-dwelling-bacteria-resistant-to-18-antibiotics/articleshow/55876850.cms
heart disease protein linked to brain damage: study /heart-disease-protein-linked-to-brain-damage-study/articleshow/55867167.cms
why getting old makes you happy /home/science/why-getting-old-makes-you-happy/articleshow/55858887.cms
cancer treatment gets delayed in india: study /home/science/cancer-treatment-starts-in-india-at-least-after-4-months-delay-finds-study/articleshow/55857759.cms
earth's days getting longer, slower: study /earths-days-getting-longer-slower-study/articleshow/55849862.cms
more » /home/environment/articlelist/2647163.cms
environment /home/environment/articlelist/2647163.cms
- /home/environment/tequila-plant-may-be-key-to-fighting-droughts-climate-change/articleshow/55870748.cms
tequila plant may be key to fighting droughts /home/environment/tequila-plant-may-be-key-to-fighting-droughts-climate-change/articleshow/55870748.cms
giraffes suffer 'silent extinction' in africa /home/environment/giraffes-suffer-silent-extinction-in-africa-red-list-report/articleshow/55866942.cms
sea ice in arctic and antarctic hit record lows  /home/environment/global-warming/sea-ice-in-arctic-and-antarctic-hit-record-lows-in-november/articleshow/55856584.cms
regions around delhi contribute to its pollution: expert /home/environment/pollution/regions-around-delhi-contribute-to-its-pollution-expert/articleshow/55841451.cms
polar bear numbers to plunge a third as sea ice melts /home/environment/polar-bear-numbers-to-plunge-a-third-as-sea-ice-melts-study/articleshow/55849365.cms
more » /home/sunday-times/sdtimes.cms
sunday times /home/sunday-times/sdtimes.cms
- /home/sunday-times/now-kids-join-the-everest-race/articleshow/55778439.cms
now, kids join the everest race /home/sunday-times/now-kids-join-the-everest-race/articleshow/55778439.cms
voluntourists come in search of the real india, but lap /home/sunday-times/voluntourists-come-in-search-of-the-real-india-but-lap-up-the-fake/articleshow/55778776.cms
now we’re saying cheese, desi style /home/sunday-times/now-were-saying-cheese-desi-style/articleshow/55517517.cms
wealthy wives come out of the closet /home/sunday-times/wealthy-wives-come-out-of-the-closet/articleshow/55517399.cms
are you one of these notable types? /home/sunday-times/are-you-one-of-these-notable-types/articleshow/55517036.cms
more » /nrihome.cms
nri /nrihome.cms
- /nri/other-news/indian-origin-uk-mp-virendra-sharma-calls-on-india-to-end-demonetisation-stress-for-nris/articleshow/55854659.cms
pio uk mp calls on india to end demonetisation stress /nri/other-news/indian-origin-uk-mp-virendra-sharma-calls-on-india-to-end-demonetisation-stress-for-nris/articleshow/55854659.cms
community newspaper 'india abroad' sold by rediff /nri/us-canada-news/community-newspaper-india-abroad-in-us-sold-by-rediff/articleshow/55832392.cms
demonetisation a huge cause of concern for nris, pios /nri/us-canada-news/demonetisation-a-huge-cause-of-concern-for-nris-pios/articleshow/55820577.cms
'british sikh woman honour killing victim in india' /nri/other-news/british-sikh-woman-victim-of-honour-killing-in-india-claims-family/articleshow/55792275.cms
hindu groups call for 'non-veg' 5-pound note withdrawal /nri/other-news/hindu-groups-in-uk-call-for-withdrawing-non-veg-5-pound-note/articleshow/55776608.cms
more » /debatelist/2138952.cms
speak out /debatelist/2138952.cms
more » /home/education/news/articlelist/913168846.cms
education /home/education/news/articlelist/913168846.cms
- /home/education/hrd-campaign-to-promote-digital-transactions-among-students/articleshow/55872411.cms
hrd to promote digital transactions among students /home/education/hrd-campaign-to-promote-digital-transactions-among-students/articleshow/55872411.cms
delhi government streamlines admission process for class /home/education/news/delhi-government-streamlines-admission-process-for-class-vi/articleshow/55857179.cms
asian countries dominate, science teaching criticised in /home/education/asian-countries-dominate-science-teaching-criticised-in-pisa-survey/articleshow/55852138.cms
college principals to get one more term: ugc's new rule /home/education/news/ugc-amends-regulations-college-principals-to-get-one-more-term/articleshow/55839060.cms
parrikar bats for facilities to differently-abled /home/education/manohar-parrikar-bats-for-facilities-to-differently-abled-students/articleshow/55772904.cms
newsletter /newsletterhome.cms
sitemap /sitemap.cms
archives /archive.cms

Linki zewnętrzne

my times http://mytimes.indiatimes.com/?channel=toi
https://www.facebook.com/timesofindia
https://twitter.com/timesofindia
https://plus.google.com/117150671992820587865?prsrc=3
http://timesofindia.indiatimes.com/rss.cms
https://www.youtube.com/user/timesofindiachannel
- http://timesofindia.indiatimes.com
beauty pageants http://beautypageants.indiatimes.com/
photos http://photogallery.indiatimes.com/
videos http://timesofindia.indiatimes.com/videos/entertainment/videolist/3812908.cms
photos http://photogallery.indiatimes.com/
videos http://timesofindia.indiatimes.com/videos
videos http://timesofindia.indiatimes.com/videos
news http://timesofindia.indiatimes.com/videos/news
entertainment http://timesofindia.indiatimes.com/videos/entertainment
celebs http://timesofindia.indiatimes.com/videos/celebs
movies http://timesofindia.indiatimes.com/videos/movies
lifestyle http://timesofindia.indiatimes.com/videos/lifestyle
sports http://timesofindia.indiatimes.com/videos/sports
tech http://timesofindia.indiatimes.com/videos/tech
business http://timesofindia.indiatimes.com/videos/business
auto http://timesofindia.indiatimes.com/videos/auto
funny http://timesofindia.indiatimes.com/videos/funny
photos http://photogallery.indiatimes.com/news/photodhamal/articlelist/14582101.cms
https://www.facebook.com/toiworldnews
markets http://economictimes.indiatimes.com/markets/markets/1977021501.cms
photos http://photogallery.indiatimes.com/news/business/articlelist/15466935.cms
https://twitter.com/toibusinessnews
https://www.facebook.com/toibusiness
tech http://www.gadgetsnow.com?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnav?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
tech news http://www.gadgetsnow.com/latest-news?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnav?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
gadgets http://www.gadgetsnow.com/mobile-phones?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnav?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
reviews http://www.gadgetsnow.com/reviews?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnav?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
slideshows http://www.gadgetsnow.com/slideshows?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnav?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
videos http://www.gadgetsnow.com/videos?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnav?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
how to http://www.gadgetsnow.com/how-to?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnav?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
featured http://www.gadgetsnow.com/featured?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnav?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
https://twitter.com/gadgetsnow
https://www.facebook.com/gadgetsnow
https://plus.google.com/109344975424839033279
https://www.linkedin.com/company/gadgetsnow
https://www.youtube.com/channel/uc4gez3knloxurtz5w3u6sua
cricket http://www.cricbuzz.com/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
cricket http://www.cricbuzz.com/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
news http://www.cricbuzz.com/cricket-news?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
results http://www.cricbuzz.com/cricket-match/live-scores?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
fixtures http://www.cricbuzz.com/cricket-schedule/series?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
columns http://www.cricbuzz.com/cricket-news/editorial?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
photos http://www.cricbuzz.com/cricket-photo-gallery?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
live cricket score http://www.cricbuzz.com/cricket-match/live-scores?utm_source=toi&utm_medium=topnav&utm_campaign=timesinternet
http://twitter.com/cricbuzz
http://www.facebook.com/cricbuzz
https://google.com/+cricbuzz
cricket http://www.cricbuzz.com/?utm_source=toisports_cricwidget&utm_medium=abtest&utm_campaign=toisports
other sports http://photogallery.indiatimes.com/sports/articlelist/2048907.cms
photos http://photogallery.indiatimes.com/sports/articlelist/2048907.cms
https://twitter.com/toisportsnews
https://www.facebook.com/toisports
beauty pageants http://beautypageants.indiatimes.com/
photos http://photogallery.indiatimes.com/
https://twitter.com/toientertain
https://www.facebook.com/toientertain
https://plus.google.com/+toientertainment/posts
http://www.pinterest.com/timesofindia/entertainment/
photos http://photogallery.indiatimes.com/tv/articlelist/2371820.cms
photos http://photogallery.indiatimes.com/
https://twitter.com/toilifestyle
https://www.facebook.com/toilifestyle
blogs http://blogs.timesofindia.indiatimes.com?utm_source=toinewhp_tilwidget&utm_medium=navli&utm_campaign=toinewhp
photos http://photogallery.indiatimes.com
photos http://photogallery.indiatimes.com
movies http://photogallery.indiatimes.com/movies/articlelist/2048925.cms
celebs http://photogallery.indiatimes.com/celebs/articlelist/2371672.cms
fashion http://photogallery.indiatimes.com/fashion/articlelist/2371395.cms
beauty pageants http://photogallery.indiatimes.com/beauty-pageants/articlelist/2371373.cms
awards http://photogallery.indiatimes.com/awards/articlelist/5479755.cms
events http://photogallery.indiatimes.com/events/articlelist/2048921.cms
tv http://photogallery.indiatimes.com/tv/articlelist/2371820.cms
sports http://photogallery.indiatimes.com/sports/articlelist/2048907.cms
gadgets http://photogallery.indiatimes.com/gadgets/articlelist/2052830.cms
news http://photogallery.indiatimes.com/news/articlelist/2048895.cms
https://twitter.com/toiphotogallery
http://www.facebook.com/timesphotogallery
http://www.pinterest.com/toiphotogallery
epaper http://epaper.timesofindia.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
times now http://www.timesnow.tv?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
live tv http://live.indiatimes.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
apps http://timesofindia.indiatimes.com/mobileapplist/7404562.cms
coupons http://www.coupondunia.in/?utm_source=toi&utm_medium=nav_link
use card, pay 0.75% less for petrol and diesel http://timesofindia.indiatimes.com/govt-demonetisation-move/liveblog/55315325.cms
live blog: junior hockey wc - india vs canada http://timesofindia.indiatimes.com/junior-hockey-world-cup-india-vs-canada/liveblog/55874933.cms
entertainment http://timesofindia.indiatimes.com/entertainment
meet the ‘uninvited guest’ at manish’s bash http://www.misskyra.com/celebs/this-actress-was-an-uninvited-guest-at-manish-malhotras-birthday-bash/articleshow/55870957.cms
anushka reacts on her dance video with virat  http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/anushka-sharma-reacts-on-her-dance-video-with-virat-kohli/articleshow/55871551.cms
big b unveils alankrita sahai's new album http://beautypageants.indiatimes.com/miss-earth/amitabh-bachchan-unveils-aap-se-mausiiquii-album-with-alankrita-sahai/eventshow/55855016.cms
-bigg boss hotties of all times! http://photogallery.indiatimes.com/celebs/celeb-themes/bigg-boss-hotties/articleshow/55876313.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-hotties hooked up in 2016! http://photogallery.indiatimes.com/celebs/celeb-themes/hotties-who-hooked-up-in-2016/articleshow/55875243.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-time mag. person of the year 2016 http://photogallery.indiatimes.com/news/world/time-magazines-person-of-the-year-2016/articleshow/55872246.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-yuvraj, hazel's starry reception http://photogallery.indiatimes.com/events/delhi/yuvraj-singh-hazel-keechs-reception-photos/articleshow/55865963.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-ranveer, vaani promote befikre http://photogallery.indiatimes.com/celebs/bollywood/ranveer-singh/parties-events/articleshow/55865992.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-celebs who died in poverty http://photogallery.indiatimes.com/celebs/celeb-themes/celebs-who-died-in-poverty/articleshow/45433234.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-cho ramaswamy passes away http://photogallery.indiatimes.com/celebs/celeb-themes/celebs-who-left-us/articleshow/55846852.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-sportsmen and their posh homes http://photogallery.indiatimes.com/celebs/celeb-themes/sportsmen-and-their-posh-homes/articleshow/48970963.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-sonam dazzles in stunning dress http://photogallery.indiatimes.com/celebs/celeb-themes/celebs-fashion-statement/articleshow/55833968.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-manish malhotra's b'day party http://photogallery.indiatimes.com/events/mumbai/manish-malhotras-birthday-bash/articleshow/55826865.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-screen awards: inside photos http://photogallery.indiatimes.com/awards/awards-and-honours/star-screen-awards-2016-inside-photos/articleshow/55808469.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-kriti sanon sizzles in backless attire http://photogallery.indiatimes.com/celebs/celeb-themes/divas-in-their-backless-best/articleshow/55810491.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-nargis fakhri's bridal avatar http://photogallery.indiatimes.com/celebs/celeb-themes/celebrity-instagram-pics/nargis/articleshow/55827013.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-cabaret dancer kisses ranveer http://photogallery.indiatimes.com/celebs/celeb-themes/most-unexpected-kisses/articleshow/55803518.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-spotted: anushka, virat at airport http://photogallery.indiatimes.com/celebs/celeb-themes/celebs-at-airport/articleshow/55802877.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
pics: indian idol judges to appear on tkss http://timesofindia.indiatimes.com/tv/news/hindi/indian-idol-judges-have-an-insane-time-on-the-kapil-sharma-show-see-pics/photostory/55875460.cms
8 facebook tricks you must know http://www.gadgetsnow.com/slideshows/8-facebook-tricks-you-must-know/photolist/55875061.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
100 delhi-bound trains delayed due to fog http://timesofindia.indiatimes.com/dense-fog-engulfs-north-india/liveblog/55699783.cms
beauty queens who died due to drug overdose http://beautypageants.indiatimes.com/others/beauty-queens-who-died-due-to-drug-overdose/eventshow/55853893.cms
airtel offers 'free unlimited calls' across india http://www.gadgetsnow.com/tech-news/airtel-offers-free-unlimited-calls-to-anywhere-in-india/articleshow/55871310.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
social humour: trump beats modi, twitter reacts http://timesofindia.indiatimes.com/india/social-humour-twitter-reacts-as-trump-pips-modi-to-bag-time-person-of-the-year-title/humour/55871740.cms
- http://timesofindia.indiatimes.com/india/social-humour-twitter-reacts-as-trump-pips-modi-to-bag-time-person-of-the-year-title/humour/55871740.cms
this confirms, apple car is not dead http://www.gadgetsnow.com/tech-news/this-confirms-apple-car-is-not-dead/articleshow/55786837.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
3 budget led tvs you can buy http://www.gadgetsnow.com/slideshows/3-budget-led-tvs-you-can-buy/photolist/55790932.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
beauty queens who died due to drug overdose http://beautypageants.indiatimes.com/others/beauty-queens-who-died-due-to-drug-overdose/eventshow/55853893.cms
benefits of putting vicks vaporub over garlic clove! http://www.speakingtree.in/blog/benefits-of-putting-vicks-vaporub-over-garlic-clove
this smartphone has a mammoth 10900mah battery http://www.gadgetsnow.com/mobiles/this-smartphone-has-a-mammoth-10900mah-battery/articleshow/55725161.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hptopnews
6 natural foods that boost brain health http://recipes.timesofindia.com/articles/health/6-natural-foods-that-boost-brain-health/5-natural-foods-that-boost-brain-health-gif/photostory/55853408.cms
video news: all in one minute @ 10am http://timesofindia.indiatimes.com/videoshow/55365543.cms
et: online or offline, iphone may cost the same http://economictimes.indiatimes.com/tech/hardware/apple-to-push-for-uniform-pricing-iphone-may-cost-same-online-or-offline/articleshow/51971781.cms?utm_source=toinewhp_etlink&utm_medium=abtest&utm_campaign=toinewhp
-hottest royal women http://photogallery.indiatimes.com/celebs/celeb-themes/hottest-royal-women/articleshow/47070783.cms
-smoking hot suntanned celebs http://photogallery.indiatimes.com/celebs/celeb-themes/smoking-hot-suntanned-celebs/articleshow/46887653.cms
-celebs in nightwear http://photogallery.indiatimes.com/celebs/celeb-themes/celebs-in-nightwear/articleshow/46987133.cms
-bold bollywood debuts! http://photogallery.indiatimes.com/celebs/celeb-themes/bold-bollywood-debuts/articleshow/52911665.cms
-hottest bikini trends http://photogallery.indiatimes.com/celebs/celeb-themes/hottest-bikini-trends/articleshow/55454885.cms
-hottest tv actresses http://photogallery.indiatimes.com/celebs/celeb-themes/hottest-tv-actresses/articleshow/53841081.cms
more » http://timesofindia.indiatimes.com/entertainment
entertainment http://timesofindia.indiatimes.com/entertainment
pic: katrina, arpita share some sister-love http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/pic-katrina-and-arpita-share-some-sister-love-at-manish-malhotras-bash/photostory/55847470.cms
ali asgar aka nani celebrates birthday on the sets http://timesofindia.indiatimes.com/tv/news/hindi/ali-asgar-aka-nani-celebrates-birthday-on-the-sets-of-the-kapil-sharma-show/photostory/55873653.cms
rashami desai http://timesofindia.indiatimes.com/tv/news/hindi/are-rashami-desai-and-sidharth-shukla-more-than-just-co-stars/articleshow/55853359.cms
nagarjun http://timesofindia.indiatimes.com/tv/news/hindi/nagarjun-ek-yoddha-to-end-next-month/articleshow/55854047.cms
bigg boss http://timesofindia.indiatimes.com/tv/news/hindi/bigg-boss-10/updates/51873781.cms
peter england mr. india 2016 webisode 2 http://beautypageants.indiatimes.com/mr-india/peter-england-mr-india-2016-webisode-2/articleshow/55875880.cms
pic: yuvraj singh-hazel keech’s glitzy wedding http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/yuvraj-singh-hazel-keechs-glitzy-wedding-reception-in-delhi/photostory/55867353.cms
dharmendra’s unforgettable dialogues http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/dharmendras-unforgettable-dialogues/photostory/45409636.cms
watch peter england mr india 2016 audition https://www.facebook.com/zoomtv/videos/10155073015744123/
more » http://www.gadgetsnow.com?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
tech http://www.gadgetsnow.com?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
news http://www.gadgetsnow.com/latest-news?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
- http://www.gadgetsnow.com/tech-news/airtel-offers-free-unlimited-calls-to-anywhere-in-india/articleshow/55871310.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
airtel offers free unlimited calls to anywhere in india http://www.gadgetsnow.com/tech-news/airtel-offers-free-unlimited-calls-to-anywhere-in-india/articleshow/55871310.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
6 tips to prevent smartphones from overheating http://www.gadgetsnow.com/slideshows/6-tips-to-prevent-smartphones-from-overheating/photolist/54963148.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
here's all that india watched the most on youtube in the year 2016 http://www.gadgetsnow.com/tech-news/heres-all-that-india-watched-the-most-on-youtube-in-the-year-2016/articleshow/55871781.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
apple iphone tops flickr's 'most popular camera list' http://www.gadgetsnow.com/tech-news/apple-iphone-once-again-tops-flickrs-most-popular-camera-list/articleshow/55870737.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
iit placements: amazon, paytm hire big http://www.gadgetsnow.com/jobs/iit-placements-amazon-paytm-hire-big/articleshow/55871170.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
reviews http://www.gadgetsnow.com/reviews?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
- http://www.gadgetsnow.com/mobile-phones/lenovo-phab-2-plus?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
lenovo phab 2 plus review: too big for 'own good' http://www.gadgetsnow.com/mobile-phones/lenovo-phab-2-plus?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
gionee p7 max review: can be skipped http://www.gadgetsnow.com/mobile-phones/gionee-p7-max?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
lenovo ideapad miix 310 review: good for basic tasks http://www.gadgetsnow.com/reviews/lenovo-ideapad-miix-310-review-good-for-basic-tasks/articleshow/55719928.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
altec lansing zine 2.0: fails to impress http://www.gadgetsnow.com/reviews/altec-lansing-zine-2-0-fails-to-impress/articleshow/55708387.cms?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
asus zenfone 3 ultra review: good looks, decent performance http://www.gadgetsnow.com/mobile-phones/asus-zenfone-3-ultra?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
- http://www.gadgetsnow.com/mobile-phones/lenovo-phab-2-plus?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
lenovo phab 2 plus http://www.gadgetsnow.com/mobile-phones/lenovo-phab-2-plus?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
- http://www.gadgetsnow.com/mobile-phones/gionee-p7-max?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
gionee p7 max http://www.gadgetsnow.com/mobile-phones/gionee-p7-max?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
- http://www.gadgetsnow.com/mobile-phones/asus-zenfone-3-ultra?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
asus zenfone 3 ultra http://www.gadgetsnow.com/mobile-phones/asus-zenfone-3-ultra?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
- http://www.gadgetsnow.com/mobile-phones/blackberry-dtek50?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
blackberry dtek50 http://www.gadgetsnow.com/mobile-phones/blackberry-dtek50?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
- http://www.gadgetsnow.com/mobile-phones/vivo-v5?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
vivo v5 http://www.gadgetsnow.com/mobile-phones/vivo-v5?utm_source=toiweb&utm_medium=referral&utm_campaign=toiweb_hpwidget
- http://timesofindia.indiatimes.com/tv/news/hindi/are-rashami-desai-and-sidharth-shukla-more-than-just-co-stars/articleshow/55853359.cms
are rashami, sidharth more than just co-stars? http://timesofindia.indiatimes.com/tv/news/hindi/are-rashami-desai-and-sidharth-shukla-more-than-just-co-stars/articleshow/55853359.cms
'nagarjun - ek yoddha' to end next month http://timesofindia.indiatimes.com/tv/news/hindi/nagarjun-ek-yoddha-to-end-next-month/articleshow/55854047.cms
bigg boss 10: know all about the show http://timesofindia.indiatimes.com/tv/news/hindi/bigg-boss-10/updates/51873781.cms
new reality show to celebrate bollywood music http://timesofindia.indiatimes.com/tv/news/hindi/now-a-singing-reality-show-to-celebrate-bollywood-music/articleshow/55846281.cms
i have zero knowledge about singing: karan johar http://timesofindia.indiatimes.com/tv/news/hindi/i-have-zero-knowledge-about-singing-karan-johar/articleshow/55846296.cms
more videos » http://timesofindia.indiatimes.com/videos
- http://timesofindia.indiatimes.com/india/a-queue-to-end-all-queues-pm-narendra-modi-hard-sells-demonetisation-in-moradabad/articleshow/55770739.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
‘a queue to end all queues’: pm narendra modi hard-sells demonetisation in moradabad http://timesofindia.indiatimes.com/india/a-queue-to-end-all-queues-pm-narendra-modi-hard-sells-demonetisation-in-moradabad/articleshow/55770739.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/city/bengaluru/over-rs-4-crore-in-new-notes-seized-in-it-raids-in-bengaluru/articleshow/55728247.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
new notes worth rs 4.7 crore seized in i-t raids in bengaluru http://timesofindia.indiatimes.com/city/bengaluru/over-rs-4-crore-in-new-notes-seized-in-it-raids-in-bengaluru/articleshow/55728247.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/india/son-has-no-legal-right-in-parents-house-can-stay-at-their-mercy-delhi-high-court/articleshow/55686401.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
son has no legal right in parents' house, can stay at their mercy: delhi high court http://timesofindia.indiatimes.com/india/son-has-no-legal-right-in-parents-house-can-stay-at-their-mercy-delhi-high-court/articleshow/55686401.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/world/pakistan/this-is-what-gave-bajwa-an-edge-in-the-race-for-pak-army-chief-post/articleshow/55649762.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
this is what gave qamar bajwa an edge in the race for pak army chief post, according to pak media http://timesofindia.indiatimes.com/world/pakistan/this-is-what-gave-bajwa-an-edge-in-the-race-for-pak-army-chief-post/articleshow/55649762.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/business/india-business/unaccounted-deposits-disclosed-to-taxman-face-50-tax-lock-in/articleshow/55620291.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
demonetisation: unaccounted deposits to attract 50% tax, 4 year lock-in period http://timesofindia.indiatimes.com/business/india-business/unaccounted-deposits-disclosed-to-taxman-face-50-tax-lock-in/articleshow/55620291.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/india/demonetisation-tightens-no-more-exchange-of-rs-500-and-rs-1000-notes-centre-announces/articleshow/55603482.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
demonetisation tightens: no more exchange of rs 500 and rs 1000 notes, centre announces http://timesofindia.indiatimes.com/india/demonetisation-tightens-no-more-exchange-of-rs-500-and-rs-1000-notes-centre-announces/articleshow/55603482.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/pic-adiras-birth-announcement-cradle-filled-with-goodies/photostory/51775537.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
pic: adira's birth announcement cradle filled with goodies! http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/pic-adiras-birth-announcement-cradle-filled-with-goodies/photostory/51775537.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/rumoured-dabangg-3-actress-leaks-topless-pics-for-publicity/photostory/51773400.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
rumoured 'dabangg 3' actress leaks topless pics for publicity? http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/rumoured-dabangg-3-actress-leaks-topless-pics-for-publicity/photostory/51773400.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/pic-abram-kissed-by-two-girls/photostory/51775398.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
pic: abram kissed by two girls! http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/pic-abram-kissed-by-two-girls/photostory/51775398.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/pic-varun-dhawan-gearing-up-for-underwater-stunts/photostory/51646087.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
pic: varun dhawan gearing up for underwater stunts http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/pic-varun-dhawan-gearing-up-for-underwater-stunts/photostory/51646087.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/pics-deepika-padukone-returns-to-xxx-sets/photostory/51646436.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
pics: deepika padukone back on ‘xxx’ sets http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/pics-deepika-padukone-returns-to-xxx-sets/photostory/51646436.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/what-made-hrithik-run-behind-his-son-hrehaan/photostory/51647421.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
what made hrithik run behind his son hrehaan? http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/what-made-hrithik-run-behind-his-son-hrehaan/photostory/51647421.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/tech/jobs/attrition-at-top-level-hurting-e-commerce-companies-in-india/articleshow/49134130.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
attrition at top level hurting e-commerce companies in india http://timesofindia.indiatimes.com/tech/jobs/attrition-at-top-level-hurting-e-commerce-companies-in-india/articleshow/49134130.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://recipes.timesofindia.com/articles/food-facts/10-banned-foods-across-the-world/haggis-in-us/photostory/55680283.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
10 banned foods across the world http://recipes.timesofindia.com/articles/food-facts/10-banned-foods-across-the-world/haggis-in-us/photostory/55680283.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/kangana-unhappy-with-hrithik-for-dragging-rangoli-into-their-legal-battle-/photostory/51648946.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
kangana unhappy with hrithik for dragging rangoli into their battle? http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/kangana-unhappy-with-hrithik-for-dragging-rangoli-into-their-legal-battle-/photostory/51648946.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/pic-arpita-khans-maternity-photoshoot/photostory/51597075.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
pic: arpita khan's maternity photoshoot http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/pic-arpita-khans-maternity-photoshoot/photostory/51597075.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/sonam-kapoor-speaks-about-her-alleged-love-affair/photostory/51596367.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
sonam kapoor speaks about her alleged love affair http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/sonam-kapoor-speaks-about-her-alleged-love-affair/photostory/51596367.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/india/over-93-percent-support-for-demonetisation-in-survey-on-pm-narendra-modis-app/articleshow/55584567.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
over 93 percent support for demonetisation in survey on pm narendra modi's app http://timesofindia.indiatimes.com/india/over-93-percent-support-for-demonetisation-in-survey-on-pm-narendra-modis-app/articleshow/55584567.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/india/if-saarc-fails-theres-bimstec-india-warns-pakistan/articleshow/55545978.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
if saarc fails, there’s bimstec: india warns pakistan http://timesofindia.indiatimes.com/india/if-saarc-fails-theres-bimstec-india-warns-pakistan/articleshow/55545978.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/india/nia-seize-incriminating-docs-rs-12-lakh-in-cash-during-raids-on-zakir-naiks-ngo/articleshow/55514036.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
incriminating documents, rs 12 lakh cash seized during raids on zakir naik's ngo http://timesofindia.indiatimes.com/india/nia-seize-incriminating-docs-rs-12-lakh-in-cash-during-raids-on-zakir-naiks-ngo/articleshow/55514036.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/azads-gift-for-aamir-will-melt-your-hearts/photostory/51393909.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
azad's gift for aamir will melt your hearts! http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/azads-gift-for-aamir-will-melt-your-hearts/photostory/51393909.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/aamir-khan-flashback-to-the-future/photostory/51382744.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
aamir khan - flashback to the future! http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/aamir-khan-flashback-to-the-future/photostory/51382744.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/sanjay-dutt-and-salman-khan-end-their-friendship/photostory/51356951.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
sanjay dutt and salman khan end their friendship? http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/sanjay-dutt-and-salman-khan-end-their-friendship/photostory/51356951.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://recipes.timesofindia.com/articles/kitchen-hacks/8-uses-of-coffee-maker-no-one-told-you/articleshow/53263920.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
8 uses of coffee maker no one told you http://recipes.timesofindia.com/articles/kitchen-hacks/8-uses-of-coffee-maker-no-one-told-you/articleshow/53263920.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/tech/tech-news/flipkart-announces-next-big-billion-sales-dates/articleshow/49138784.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
flipkart announces next big billion sale’s dates http://timesofindia.indiatimes.com/tech/tech-news/flipkart-announces-next-big-billion-sales-dates/articleshow/49138784.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/tech/tech-news/what-happens-when-iphone-6s-is-dipped-in-water/articleshow/49138476.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
what happens when iphone 6s is dipped in water http://timesofindia.indiatimes.com/tech/tech-news/what-happens-when-iphone-6s-is-dipped-in-water/articleshow/49138476.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/tech/tech-news/chandigarh-man-sells-water-pumps-online-gets-google-ceos-praise/articleshow/49135198.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
chandigarh man sells water pumps online, gets google ceo's praise http://timesofindia.indiatimes.com/tech/tech-news/chandigarh-man-sells-water-pumps-online-gets-google-ceos-praise/articleshow/49135198.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
latest gadgets http://timesofindia.indiatimes.com/tech/more-gadgets
navbharat times http://navbharattimes.indiatimes.com/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
coupons & offers http://www.coupondunia.in
- https://www.coupondunia.in/amazon?h=yrxomykpss&utm_source=toi&utm_medium=widget&utm_campaign=toifeed
deal of the day: upto 85% off on deals every hour https://www.coupondunia.in/amazon?h=yrxomykpss&utm_source=toi&utm_medium=widget&utm_campaign=toifeed
- https://www.coupondunia.in/flipkart?h=ixxffziyfs&utm_source=toi&utm_medium=widget&utm_campaign=toifeed
flat rs. 7,000 off on apple iphone 6 https://www.coupondunia.in/flipkart?h=ixxffziyfs&utm_source=toi&utm_medium=widget&utm_campaign=toifeed
- https://www.coupondunia.in/nearbuy?h=xrp0ohjnns&utm_source=toi&utm_medium=widget&utm_campaign=toifeed
offer of the day: flat 40% cashback on travel deals https://www.coupondunia.in/nearbuy?h=xrp0ohjnns&utm_source=toi&utm_medium=widget&utm_campaign=toifeed
- https://www.coupondunia.in/makemytrip?h=ytriezepps&utm_source=toi&utm_medium=widget&utm_campaign=toifeed
coupondunia exclusive: upto rs. 1000 cashback on domestic fl https://www.coupondunia.in/makemytrip?h=ytriezepps&utm_source=toi&utm_medium=widget&utm_campaign=toifeed
- https://www.coupondunia.in/ebay?h=knioxqjoss&utm_source=toi&utm_medium=widget&utm_campaign=toifeed
flat 25% off on your first purchase (new users only) https://www.coupondunia.in/ebay?h=knioxqjoss&utm_source=toi&utm_medium=widget&utm_campaign=toifeed
- http://epaper.timesofindia.com
- http://in.mobile.indiatimes.com/mobile/liveastro/index.html
live astrology http://in.mobile.indiatimes.com/mobile/liveastro/index.html
free sms from pc to any mobile http://www.mocolife.com/user/index.aspx
best selling videos for your mobile http://mobile.indiatimes.com/cathome.html?ctype=8&type=1
latest news on your mobile http://mobile.indiatimes.com/catdata.html?ctype=1&cat=3&type=0
more » http://mobile.indiatimes.com/
free mri, ct scan for the poor in delhi http://timesofindia.indiatimes.com/city/delhi/free-mri-ct-scan-for-the-poor/articleshow/55850356.cms
- http://timesofindia.indiatimes.com/life-style/relationships/8-pictures-that-redefine-motherhood/photostory/55873216.cms
8 pictures that redefine motherhood http://timesofindia.indiatimes.com/life-style/relationships/8-pictures-that-redefine-motherhood/photostory/55873216.cms
more » http://www.femina.in/?utm_source=toinewhp_tilwidget&utm_medium=referral&utm_campaign=toinewhp
femina http://www.femina.in/?utm_source=toinewhp_tilwidget&utm_medium=referral&utm_campaign=toinewhp
- http://www.femina.in/relationships/love-sex/signs-that-you-are-commitment-phobic-31973.html?utm_source=toinewhp_tilwidget&utm_medium=referral&utm_campaign=toinewhp
signs that you are commitment phobic http://www.femina.in/relationships/love-sex/signs-that-you-are-commitment-phobic-31973.html?utm_source=toinewhp_tilwidget&utm_medium=referral&utm_campaign=toinewhp
6 ways to revive tired face makeup http://www.femina.in/beauty/skin/6-ways-to-revive-tired-face-makeup-21795.html?utm_source=toinewhp_tilwidget&utm_medium=referral&utm_campaign=toinewhp
5 must-have shoes for your winter closet http://www.femina.in/fashion/trends/5-musthave-shoes-for-your-winter-closet-28577.html?utm_source=toinewhp_tilwidget&utm_medium=referral&utm_campaign=toinewhp
how technology can improve your sex life http://www.femina.in/relationships/love-sex/how-technology-can-improve-your-sex-life-27838.html?utm_source=toinewhp_tilwidget&utm_medium=referral&utm_campaign=toinewhp
starters with a twist to wow your guests http://www.femina.in/life/food/starters-with-a-twist-to-wow-your-guests-31238.html?utm_source=toinewhp_tilwidget&utm_medium=referral&utm_campaign=toinewhp
more » http://feminamissindia.indiatimes.com/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
beauty pageants http://feminamissindia.indiatimes.com/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://beautypageants.indiatimes.com/mr-india/peter-england-mr-india-2016-webisode-1/articleshow/55854621.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
peter england mr. india 2016 webisode 1 http://beautypageants.indiatimes.com/mr-india/peter-england-mr-india-2016-webisode-1/articleshow/55854621.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
rajasthan chief minister congratulates jitesh thakur http://beautypageants.indiatimes.com/mr-india/rajasthan-chief-minister-vasundhara-raje-congratulates-jitesh-thakur/articleshow/55855230.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
amitabh bachchan unveils alankrita sahai's new album http://beautypageants.indiatimes.com/miss-earth/amitabh-bachchan-unveils-aap-se-mausiiquii-album-with-alankrita-sahai/eventshow/55855016.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
beauty queens who died due to drug overdose http://beautypageants.indiatimes.com/others/beauty-queens-who-died-due-to-drug-overdose/eventshow/55853893.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
beauty queens grieve for jayalalithaa http://beautypageants.indiatimes.com/miss-diva/beauty-queens-offer-condolences-to-jayalalithaa/eventshow/55836185.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://www.happytrips.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
travel http://www.happytrips.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-mysterious kutch http://www.happytrips.com/destinations/mysterious-kutch/ss34075137.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
11 stunning indian hotels you probably haven't stayed at but should http://www.happytrips.com/hotels/11-stunning-indian-hotels-you-probably-havent-stayed-at-but-should/ss39880732.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
pahalgam’s best budget beds http://www.happytrips.com/pahalgam/travel-guide/pahalgams-best-budget-beds/gs49949338.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
top beaches in india http://www.happytrips.com/destinations/top-beaches-in-india/ss35018952.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
places near shimla that are perfect for weekend getaways http://www.happytrips.com/shimla/travel-guide/places-near-shimla-that-are-perfect-for-weekend-getaways/gs36353230.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://timesofindia.speakingtree.in/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
spirituality http://timesofindia.speakingtree.in/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://www.speakingtree.in/slideshow/women-of-these-3-zodiac-signs-are-perfect-for-marriage?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
women of these 3 zodiac signs are perfect for marriage! http://www.speakingtree.in/slideshow/women-of-these-3-zodiac-signs-are-perfect-for-marriage?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
career predictions 2017: will you be successful? http://www.speakingtree.in/slideshow/career-predictions-for-year-2017?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
gita jayanti on december 10: here's what you should do! http://www.speakingtree.in/slideshow/gita-jayanti-falls-on-december-10-heres-what-you-should-do?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
meaning and interpretation of dreams in islam http://www.speakingtree.in/slideshow/meaning-of-dream-in-islam?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
forecast 2017: luck or misfortune, what it would be? http://www.speakingtree.in/slideshow/horoscope-special-what-will-the-upcoming-year-bring-you?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://timesofindia.indiatimes.com/timesnews
times news - radio http://timesofindia.indiatimes.com/timesnews
- http://timesofindia.indiatimes.com/timesnews?active=55846968
two coaches of capital express derail, 34 injured http://timesofindia.indiatimes.com/timesnews?active=55846968
cho ramaswamy passes away at 82 http://timesofindia.indiatimes.com/timesnews?active=55846939
tn bids tearful farewell to 'amma' jayalalithaa http://timesofindia.indiatimes.com/timesnews?active=55847649
mamta flight: 6 pilots of three airlines grounded http://timesofindia.indiatimes.com/timesnews?active=55847809
jayalalithaa buried next to mgr in marina beach http://timesofindia.indiatimes.com/timesnews?active=55838400
- http://timesofindia.indiatimes.com/junior-hockey-world-cup-india-vs-canada/liveblog/55874933.cms
live blog: junior hockey world cup - india vs canada http://timesofindia.indiatimes.com/junior-hockey-world-cup-india-vs-canada/liveblog/55874933.cms
more » http://www.cricbuzz.com/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
cricket http://www.cricbuzz.com/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
-ashwin rattles england after jennings debut ton http://www.cricbuzz.com/cricket-news/84607/india-cricket-team-vs-england-4th-test-r-ashwin-rattles-england-after-keaton-jennings-debut-ton?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
umpire paul reiffel suffers freak injury http://www.cricbuzz.com/cricket-news/84603/india-vs-england-4th-test-umpire-paul-reiffel-suffers-freak-injury?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
mathews, chandimal return for south africa tour http://www.cricbuzz.com/cricket-news/84606/mathews-chandimal-return-to-sri-lanka-squad-for-south-africa-tour?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
gung-ho australia eye chappell-hadlee series sweep http://www.cricbuzz.com/cricket-news/84602/australia-vs-new-zealand-gung-ho-australia-eye-chappell-hadlee-series-sweep?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
maxwell in line for return in melbourne dead-rubber http://www.cricbuzz.com/cricket-news/84599/glenn-maxwell-in-line-for-return-in-melbourne-dead-rubber-australia-vs-new-zealand-chappell-hadlee-series?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
mohammad asghar called up as back-up for yasir shah http://www.cricbuzz.com/cricket-news/84601/australia-vs-pakistan-mohammad-asghar-called-up-as-back-up-for-yasir-shah?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
lucknow could host matches in ipl 10 http://www.cricbuzz.com/cricket-news/84595/ipl-10-lucknow-could-host-matches-in-indian-premier-league-2017?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
getting ton in lahli was a turning point: panchal http://www.cricbuzz.com/cricket-news/84598/ranji-trophy-2016-17-getting-hundred-in-lahli-was-a-turning-point-priyank-panchal?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
rahane ruled out, pandey named replacement http://www.cricbuzz.com/cricket-news/84580/india-v-england-manish-pandey-replaces-rahane-thakur-comes-in-as-back-up-for-shami?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
australia name unchanged squad for brisbane test http://www.cricbuzz.com/cricket-news/84594/australia-cricket-team-name-unchanged-squad-for-brisbane-test-against-pakistan-cricket-team?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
manish pandey's time to 'be the hero' is here http://www.cricbuzz.com/cricket-news/84589/manish-pandeys-time-to-be-the-hero-is-here-india-v-england-4th-test?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://timesofindia.indiatimes.com/india/social-humour-twitter-reacts-as-trump-pips-modi-to-bag-time-person-of-the-year-title/humour/55871740.cms
social humour: trump beats modi, twitter reacts http://timesofindia.indiatimes.com/india/social-humour-twitter-reacts-as-trump-pips-modi-to-bag-time-person-of-the-year-title/humour/55871740.cms
- http://timesofindia.indiatimes.com/india/social-humour-twitter-reacts-as-trump-pips-modi-to-bag-time-person-of-the-year-title/humour/55871740.cms
social humour: best raees memes on twitter http://timesofindia.indiatimes.com/india/social-humour-twitter-explodes-with-memes-after-raees-trailer/humour/55853998.cms
- http://timesofindia.indiatimes.com/india/social-humour-twitter-explodes-with-memes-after-raees-trailer/humour/55853998.cms
social humour: jokes on salman's virginity back http://timesofindia.indiatimes.com/india/social-humour-salman-again-claims-to-be-a-virgin-funny-reactions-follow/humour/55851460.cms
- http://timesofindia.indiatimes.com/india/social-humour-salman-again-claims-to-be-a-virgin-funny-reactions-follow/humour/55851460.cms
8 times when aadhar card makers got it wrong http://timesofindia.indiatimes.com/photostories/8-times-aadhar-card-makers-got-it-hilariously-wrong/photostory/55834333.cms
more » http://content.magicbricks.com/?fromsite=toi&utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
real estate http://content.magicbricks.com/?fromsite=toi&utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://content.magicbricks.com/industry-news/will-compensate-buyers-if-property-value-falls-assure-builders/89164.html?fromsite=toi&utm_source=toi&utm_medium=referral&utm_campaign=toi-mb-whitelabel
will compensate buyers if property value falls, assure http://content.magicbricks.com/industry-news/will-compensate-buyers-if-property-value-falls-assure-builders/89164.html?fromsite=toi&utm_source=toi&utm_medium=referral&utm_campaign=toi-mb-whitelabel
loans to be cheaper as rbi eases additional crr norm http://content.magicbricks.com/industry-news/loans-to-be-cheaper-as-rbi-eases-additional-crr-norm/89165.html?fromsite=toi&utm_source=toi&utm_medium=referral&utm_campaign=toi-mb-whitelabel
pune metro rail project gets go-ahead from centre http://content.magicbricks.com/industry-news/pune-real-estate-news-industry-news/pune-metro-rail-project-gets-go-ahead-from-centre/89176.html?fromsite=toi&utm_source=toi&utm_medium=referral&utm_campaign=toi-mb-whitelabel
who will inherit rs 90-crore poes garden bungalow? http://content.magicbricks.com/industry-news/chennai-real-estate-news/who-will-inherit-rs-90-crore-poes-garden-bungalow/89161.html?fromsite=toi&utm_source=toi&utm_medium=referral&utm_campaign=toi-mb-whitelabel
real estate industry reacts on unchanged key rates http://content.magicbricks.com/industry-news/industry-reacts-on-rbis-keeping-key-rates-unchanged/89163.html?fromsite=toi&utm_source=toi&utm_medium=referral&utm_campaign=toi-mb-whitelabel
more » http://blogs.timesofindia.indiatimes.com/?utm_source=toinewhp_tilwidget&utm_campaign=toinewhp&utm_medium=widget_head
blogs http://blogs.timesofindia.indiatimes.com/?utm_source=toinewhp_tilwidget&utm_campaign=toinewhp&utm_medium=widget_head
- http://blogs.timesofindia.indiatimes.com/toi-editorials/after-jayalalithaa-panneerselvam-is-on-uncharted-terrain-as-chief-minister-of-tamil-nadu/
after jayalalithaa: panneerselvam is on uncharted terrain as cm of tamil nadu http://blogs.timesofindia.indiatimes.com/toi-editorials/after-jayalalithaa-panneerselvam-is-on-uncharted-terrain-as-chief-minister-of-tamil-nadu/
ins betwa accident highlights, once again, operational rot within navy http://blogs.timesofindia.indiatimes.com/toi-editorials/keeling-over-ins-betwa-accident-highlights-once-again-operational-rot-within-navy/
amrit dhillon: closing of the liberal mind http://blogs.timesofindia.indiatimes.com/toi-edit-page/closing-of-the-liberal-mind-by-being-shrill-dogmatic-and-smug-liberals-are-losing-their-defining-characteristic/
more » http://idiva.com/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
women http://idiva.com/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://www.idiva.com/news-entertainment/these-old-pictures-of-7bollywood-actresses-will-take-you-back-in-time/16112114?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
old pics of bollywood actresses http://www.idiva.com/news-entertainment/these-old-pictures-of-7bollywood-actresses-will-take-you-back-in-time/16112114?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
grunge make-up from celebrities http://www.idiva.com/news-style-beauty/5-times-bollywood-celebrities-gave-us-90s-grunge-beauty-inspiration/1611305?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
an interview with jeweller nirav modi http://www.luxpresso.com/news-jewellery/an-interview-nirav-modi-on-his-international-jewellery-business/16112844?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
real brides wear berry lips for their wedding http://www.idiva.com/news-style-beauty/5-times-brides-showed-us-that-berry-lips-are-perfect-for-a-fall-wedding/16120232?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
have a fling at your friend's wedding http://www.idiva.com/news-relationships/attending-a-wedding-this-season-heres-how-to-have-the-most-epic-wedding-fling/16113097?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
parliament session live http://timesofindia.indiatimes.com/winter-session-of-parliament/liveblog/55427788.cms
panneerselvam http://timesofindia.indiatimes.com/city/chennai/we-are-with-you-modi-to-ops/articleshow/55843288.cms
sasikala natarajan http://timesofindia.indiatimes.com/city/chennai/cm-in-place-now-hunt-on-for-party-general-secretary/articleshow/55846337.cms
demonetisation http://timesofindia.indiatimes.com/demonetisation-government-steps-to-ease-impact-from-note-ban/listshow/55747402.cms
narendra modi http://timesofindia.indiatimes.com/topic/narendra-modi
india canada hockey live http://timesofindia.indiatimes.com/junior-hockey-world-cup-india-vs-canada/liveblog/55874933.cms
currency demonetisation http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/pic-sunny-leones-hot-photoshoot-with-husband/photostory/52140390.cms
india eng live score http://timesofindia.indiatimes.com/sports/cricket/england-in-india-2016/sports/india-v-england-mumbai-4th-test/liveblog/55865464.cms
coffee with karan season 5 http://timesofindia.indiatimes.com/tv/news/hindi/revealed-shahid-kapoors-first-pic-with-wife-mira-on-koffee-with-karan-couch/articleshow/55744123.cms
mamata banerjee http://timesofindia.indiatimes.com/city/kolkata/army-moves-away-but-mamata-stays-put-in-office/articleshow/55737702.cms
deepwater horizon review http://timesofindia.indiatimes.com/entertainment/english/movie-reviews/deepwater-horizon/movie-review/55867097.cms
dilip kumar hospitalised http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/dilip-kumar-hospitalised/articleshow/55835881.cms
kaabil hoon song http://timesofindia.indiatimes.com/entertainment/hindi/music/news/hrithik-roshan-and-yami-gautams-song-kaabil-hoon-out/articleshow/55866269.cms
raees trailer http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/kaabil-raees-clash-rakesh-roshan-reacts-as-srk-advances-release/articleshow/55853260.cms
befikre http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/befikre-why-we-are-keenly-looking-forward-to-the-film/photostory/52869714.cms
virat kohli golden tweet http://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/virat-kohlis-post-supporting-anushka-sharma-declared-the-golden-tweet-of-2016/articleshow/55848486.cms
- http://timesofindia.indiatimes.com/home/speak-out/debateshow/50038432.cms
do you think setting kra's for students and teachers http://timesofindia.indiatimes.com/home/speak-out/debateshow/50038432.cms
is the maharashtra government really serious about http://timesofindia.indiatimes.com/home/speak-out/debateshow/50038388.cms
has the bjp-led civic body let nagpur down? http://timesofindia.indiatimes.com/home/speak-out/debateshow/49287213.cms
should private hospitals be asked to reserve 20% beds for http://timesofindia.indiatimes.com/home/speak-out/debateshow/47197871.cms
is prohibition on liquor right or wrong, why? http://timesofindia.indiatimes.com/home/speak-out/debateshow/47183824.cms
https://itunes.apple.com/us/app/the-times-of-india/id427589329?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
https://play.google.com/store/apps/details?id=com.toi.reader.activities&utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
http://appworld.blackberry.com/webstore/content/36532/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
https://itunes.apple.com/us/app/the-times-of-india-for-ipad/id427164653?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
http://www.windowsphone.com/en-in/store/app/the-times-of-india/26c39c5c-7a5a-4173-9a93-7c5bd539d4c8?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://www.zigwheels.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
zigwheels.com http://www.zigwheels.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- https://www.zigwheels.com/forum/posts/21132-isuzu-d-max-v-cross-review?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
off-roading review: isuzu d-max v-cross https://www.zigwheels.com/forum/posts/21132-isuzu-d-max-v-cross-review?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
how to prepare your car for the winter https://www.zigwheels.com/forum/posts/21143-prepare-your-car-for-the-winter?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
tvs apache rtr 200 4v- detailed review https://www.zigwheels.com/forum/posts/21385-tvs-apache-rtr-200-4v-detailed-review?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
effect of demonetization on the auto industry https://www.zigwheels.com/forum/posts/21153-cash-crunch-effect-of-demonetisation-on-cars-and-bikes-in-india?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
exclusive - car loan emi calculator https://www.zigwheels.com/emi-calculator?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://www.huffingtonpost.in/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
the huffington post http://www.huffingtonpost.in/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://www.businessinsider.in?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
business insider india http://www.businessinsider.in?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://www.in.techradar.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
techradar india http://www.in.techradar.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
market http://economictimes.indiatimes.com/markets?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
stay with dividend payers: 15 names to bet on http://economictimes.indiatimes.com/markets/stocks/news/uncertain-about-stock-returns-stay-with-dividend-payers-top-15-names-to-bet-on/articleshow/55869222.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
top 4 factors fuelling rally in sensex on thursday http://economictimes.indiatimes.com/markets/stocks/news/dalal-street-on-a-high-top-4-factors-fuelling-the-rally-in-sensex/articleshow/55867879.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
rs 11.5l cr deposits! did rbi double-count new & http://economictimes.indiatimes.com/markets/stocks/news/rs-11-5-lakh-crore-deposits-did-rbi-double-count-both-new-and-old-notes/articleshow/55867288.cms?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://economictimes.indiatimes.com/markets/technical_charts.cms?symbol=sensex&exchange=bse&entity=index&chart_type=mountain&cs=toi
- http://economictimes.indiatimes.com/markets/technical_charts.cms?symbol=nse%20index&exchange=nse&entity=index&chart_type=mountain&cs=toi
more » https://www.coursera.org/browse?languages=en&utm_medium=til&utm_source=toi&utm_campaign=hpwidget
learn at coursera https://www.coursera.org?utm_medium=til&utm_source=toi&utm_campaign=hpwidget
more » http://www.gizmodo.in?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
gizmodo india http://www.gizmodo.in?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://www.mensxp.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
mensxp http://www.mensxp.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://ww.itimes.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
itimes http://ww.itimes.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://ww.itimes.com/photo/priyanka-jagga-returns-to-bb10-as-wild-card-entry?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
bigg boss' priyanka jagga's personal life! http://ww.itimes.com/photo/priyanka-jagga-returns-to-bb10-as-wild-card-entry?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
sunny leone's sexiest photos http://ww.itimes.com/photo/sunny-leone-hot-and-sexy-photos?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
virat-anushka like never before: pics http://ww.itimes.com/blog/5-times-virat-kohli-and-anushka-sharma-gave-us-couple-goals?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
b'day: dharmendra's unknown facts http://ww.itimes.com/photo/dharmendra-turns-81?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
vote: times most desirable female-kolkata http://ww.itimes.com/times-polls/calcutta-times-most-desirable-women-2016-bengali?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://www.lifehacker.co.in?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
lifehacker http://www.lifehacker.co.in?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://content.timesjobs.com/?fromsite=toi&utm_source=toi&utm_medium=referral&utm_campaign=toi-tj-whitelabel?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
jobs http://content.timesjobs.com/?fromsite=toi&utm_source=toi&utm_medium=referral&utm_campaign=toi-tj-whitelabel?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://content.timesjobs.com/7-ways-communicating-employees/?fromsite=toi&utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
7 communication tips to retain employees http://content.timesjobs.com/7-ways-communicating-employees/?fromsite=toi&utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
travel & hospitality generated most jobs in nov http://content.timesjobs.com/travel-hospitality-grabbed-jobs-nov2016/?fromsite=toi&utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
5 signs that you will get promotion soon  http://content.timesjobs.com/5-signs-will-get-promotion-soon5-signs-that-you-will-get-promotion-soon/?fromsite=toi&utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
can micro-entrepreneurs resolve unemployment? http://content.timesjobs.com/can-micro-entrepreneurs-resolve-unemployment-india/?fromsite=toi&utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
is b-school placement culture healthy? http://content.timesjobs.com/b-school-placement-culture-healthy/?fromsite=toi&utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://www.indiatimes.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
indiatimes http://www.indiatimes.com?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://www.goal.com/en-india?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
goal http://www.goal.com/en-india?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://www.filmfare.com/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
filmfare http://www.filmfare.com/?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
- http://www.filmfare.com/photos/sonakshi-sinha-and-bunty-sachdev-party-together-15969.html?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
sonakshi sinha and bunty sachdev party together http://www.filmfare.com/photos/sonakshi-sinha-and-bunty-sachdev-party-together-15969.html?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
movie review: mirzya http://www.filmfare.com/reviews/movie-review-mirzya-15967.html?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
randeep hooda and vidyut jammwal refuse sarkar... http://www.filmfare.com/news/randeep-hooda-and-vidyut-jammwal-refuse-sarkar-3_-15972.html?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
guess who was ranveer singh bonding with big... http://www.filmfare.com/news/guess-who-was-ranveer-singh-bonding-with-big-time-in-paris-15971.html?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
hrithik roshan, jacqueline fernandez, zoya... http://www.filmfare.com/photos/hrithik-roshan-jacqueline-fernandez-zoya-akhtar-watch-mirzya-15968.html?utm_source=toinewhp_tilwidget&utm_medium=abtest&utm_campaign=toinewhp
more » http://www.boxtv.com/?utm_source=toi&utm_medium=widget&utm_campaign=toihp
boxtv http://www.boxtv.com/?utm_source=toi&utm_medium=widget&utm_campaign=toihp
- http://www.boxtv.com/movies/watch-echoes-english-movie-online?utm_source=toi&utm_medium=widget&utm_campaign=toihp&play
watch echoes 2015 english movie online http://www.boxtv.com/movies/watch-echoes-english-movie-online?utm_source=toi&utm_medium=widget&utm_campaign=toihp&play
watch alone 2015 hindi movie online http://www.boxtv.com/movies/watch-alone-2015-online?utm_source=toi&utm_medium=widget&utm_campaign=toihp&play
watch dirty politics 2015 hindi movie online http://www.boxtv.com/movies/watch-dirty-politics-online?utm_source=toi&utm_medium=widget&utm_campaign=toihp&play
watch against the sun 2015 english movie... http://www.boxtv.com/movies/watch-against-the-sun-2015-english-movies-online?utm_source=toi&utm_medium=widget&utm_campaign=toihp&play
trailers http://www.boxtv.com/movies/trailer?utm_source=toi&utm_medium=widget&utm_campaign=toihp
movies http://www.boxtv.com/movies/free-movies?utm_source=toi&utm_medium=widget&utm_campaign=toihp
hindi http://www.boxtv.com/watch-hindi-movies-online?utm_source=toi&utm_medium=widget&utm_campaign=toihp
english http://www.boxtv.com/watch-english-movies-online?utm_source=toi&utm_medium=widget&utm_campaign=toihp
tamil http://www.boxtv.com/watch-tamil-movies-online?utm_source=toi&utm_medium=widget&utm_campaign=toihp
telugu http://www.boxtv.com/watch-telugu-movies-online?utm_source=toi&utm_medium=widget&utm_campaign=toihp
listen to music online free http://gaana.com/music-album/
http://gaana.com/redirect.php?section=home&url=http://gaana.com
- http://gaana.com/streamalbum/dangal-hindi?ref=toi
dangal http://gaana.com/streamalbum/dangal-hindi?ref=toi
pritam http://gaana.com/artist/pritam?ref=toi
- http://gaana.com/streamalbum/dangal-hindi?ref=toi
- http://gaana.com/streamalbum/starboy--2016?ref=toi
starboy http://gaana.com/streamalbum/starboy--2016?ref=toi
- http://gaana.com/streamalbum/starboy--2016?ref=toi
- http://gaana.com/streamalbum/kaabil?ref=toi
kaabil http://gaana.com/streamalbum/kaabil?ref=toi
rajesh roshan http://gaana.com/artist/rajesh-roshan?ref=toi
- http://gaana.com/streamalbum/kaabil?ref=toi
- http://gaana.com/streamalbum/black-barbies-?ref=toi
black barbies http://gaana.com/streamalbum/black-barbies-?ref=toi
nicki minaj http://gaana.com/artist/nicki-minaj?ref=toi
- http://gaana.com/streamalbum/black-barbies-?ref=toi
- http://gaana.com/streamalbum/befikre?ref=toi
befikre http://gaana.com/streamalbum/befikre?ref=toi
vishal-shekhar http://gaana.com/artist/vishal-shekhar?ref=toi
- http://gaana.com/streamalbum/befikre?ref=toi
- http://gaana.com/streamalbum/darkness-and-light?ref=toi
darkness and light http://gaana.com/streamalbum/darkness-and-light?ref=toi
- http://gaana.com/streamalbum/darkness-and-light?ref=toi
about us http://www.timesinternet.in
privacy policy http://www.indiatimes.com/privacypolicy
create your own ad https://www.ads.timesinternet.in/expresso/selfservice/loginselfservice.htm
advertise with us http://advertise.indiatimes.com/
feedback http://timesofindia.indiatimes.com/feedback.cms
toi mobile http://m.timesofindia.com/
terms of use and grievance redressal policy http://www.indiatimes.com/termsandcondition
rss http://timesofindia.indiatimes.com/rss.cms
epaper http://epaper.timesofindia.com/
the economic times http://economictimes.indiatimes.com/
इकनॉमिक टाइम्स http://hindi.economictimes.indiatimes.com/
ઈકોનોમિક ટાઈમ્સ http://gujarati.economictimes.indiatimes.com/
pune mirror http://www.punemirror.in/
bangalore mirror http://www.bangaloremirror.com/
ahmedabad mirror http://www.ahmedabadmirror.com/
itsmyascent http://www.itsmyascent.com/
education times http://www.educationtimes.com/
brand capital http://brandcapital.co.in
mumbai mirror http://www.mumbaimirror.com/
times now http://www.timesnow.tv/
indiatimes http://www.indiatimes.com/
नवभारत टाइम्स http://navbharattimes.indiatimes.com/
महाराष्ट्र टाइम्स http://maharashtratimes.indiatimes.com/
ವಿಜಯ ಕರ್ನಾಟಕ http://vijaykarnataka.indiatimes.com/
go green http://gogreenindia.co.in
lifehacker india http://www.lifehacker.co.in/
gizmodo india http://www.gizmodo.in/
eisamay http://eisamay.indiatimes.com/
ign india http://in.ign.com/
navgujarat samay http://navgujaratsamay.indiatimes.com/
tamil news http://tamil.samayam.com
telugu news http://telugu.samayam.com
miss kyra http://www.misskyra.com
hindi news http://navbharattimes.indiatimes.com/
filmipop hindi https://hindi.filmipop.com
idiva http://idiva.com/index.php?host=toi
entertainment http://timesofindia.indiatimes.com/entertainment
zoom http://www.zoomtv.in/
luxpresso http://luxpresso.com
mobile phones http://www.gadgetsnow.com/mobile-phones
online songs http://gaana.com/newrelease
mensxp.com http://mensxp.com
hotels http://www.happytrips.com/hotels
travel destinations http://www.happytrips.com/destinations
smartapp https://www.getsmartapp.com/
cricbuzz.com http://cricbuzz.com
filmfare http://www.filmfare.com
femina http://www.femina.in
grazia http://www.grazia.co.in
filmipop http://www.filmipop.com
bombay times http://www.bombaytimes.com
itimes http://ww.itimes.com
cricket news http://timesofindia.indiatimes.com/cricket
sunny leone bikini pics http://photogallery.indiatimes.com/celebs/celeb-themes/sunny-leone-bikini-pics/articleshow/54376383.cms
how to get pregnant http://timesofindia.indiatimes.com/life-style/relationships/love-sex/heres-how-to-get-pregnant-faster/articleshow/51629585.cms
latest news http://timesofindia.indiatimes.com/india/breaking-news/livenews/54474561.cms
book print ads http://www.ads2book.com/
online shopping http://shopping.indiatimes.com/
matrimonial http://www.simplymarry.com/
astrology http://www.astrospeak.com
jobs http://www.timesjobs.com/
tech community http://www.techgig.com
property http://www.magicbricks.com/
buy car http://www.zigwheels.com/
bikes in india http://www.zigwheels.com/bikes
deals http://www.coupondunia.in/
free classifieds http://www.yolist.com
used cars http://www.zigwheels.com/used-car
restaurants in delhi http://www.dineout.co.in/delhi-restaurants
movie show timings http://www.filmipop.com/mumbai
remit to india http://www.timesofmoney.com/remittance/jsp/home.jsp
listen songs http://gaana.com
timesmobile http://www.timesmobile.in
real estate developers http://property.magicbricks.com/
restaurant deals in delhi http://dineout.co.in/
mobile recharge https://play.google.com/store/apps/details?id=com.getsmartapp
bollywood news https://play.google.com/store/apps/details?id=in.tml.and.bollynews&hl=en
bank exam app https://play.google.com/store/apps/details?id=co.gradeup.android&hl=en&utm_source=organic_toi&utm_medium=backlink&utm_term=kw_bankexamapp&utm_campaign=toi_backlink
itimes entertainment app https://play.google.com/store/apps/details?id=com.til.itimes.mobile&hl=en
etmoney finance app https://play.google.com/store/apps/details?id=com.smartspends
beauty care http://timesofindia.indiatimes.com/life-style/beauty
recipes http://timesofindia.indiatimes.com/life-style/food/recipes
movie reviews http://timesofindia.indiatimes.com/entertainment/movie-reviews
weather today http://timesofindia.indiatimes.com/weather.cms
google pixel price in india http://www.gadgetsnow.com/mobiles/google-launches-pixel-pixel-xl-smartphones-with-android-7-1-nougat/articleshow/54682741.cms
iphone 7 plus review http://www.gadgetsnow.com/reviews/apple-iphone-7-plus-review-at-first-it-did-not-seem-like-it-but-apple-has-done-it-again/articleshow/54848283.cms
diwali pooja 2016 http://timesofindia.indiatimes.com/topic/diwali-pooja
bigg boss 10 http://timesofindia.indiatimes.com/tv/news/hindi/bigg-boss-10/updates/51873781.cms
https://www.facebook.com/timesofindia
https://twitter.com/timesofindia
https://plus.google.com/117150671992820587865?prsrc=3
jayalalitha http://timesofindia.indiatimes.com/india/tn-bids-a-calm-tearful-farewell-as-jaya-is-laid-to-rest-next-to-mgr-grave/articleshow/55843387.cms
bigg boss 10 http://timesofindia.indiatimes.com/tv/news/hindi/bigg-boss-10/updates/51873781.cms
sasikala natarajan http://timesofindia.indiatimes.com/city/chennai/on-jayalalithaas-last-journey-it-is-sasikalaa-and-family-all-the-way/articleshow/55846578.cms
currency demonetization http://timesofindia.indiatimes.com/demonetisation-opposition-parties-observe-bharat-bandh-jan-aakrosh-diwas/liveblog/55315325.cms
india vs canada hockey live http://timesofindia.indiatimes.com/junior-hockey-world-cup-india-vs-canada/liveblog/55874933.cms
new rs2000 note http://timesofindia.indiatimes.com/pm-modis-address-to-the-nation/liveblog/55315325.cms
india england live score http://timesofindia.indiatimes.com/sports/cricket/england-in-india-2016/sports/india-v-england-mumbai-4th-test/liveblog/55865464.cms
parliament session live http://timesofindia.indiatimes.com/winter-session-of-parliament/liveblog/55427788.cms
cyclone in andaman http://timesofindia.indiatimes.com/india/1400-tourists-stuck-as-storm-hits-andaman/articleshow/55863797.cms
times syndication service http://timescontent.com/
-` http://ad.doubleclick.net/n7176/jump/toi_test/toi_test_1x1;sz=1x1;ord=[timestamp]?

Zdjęcia

Zdjęcia 186
Zdjęcia bez atrybutu ALT 73
Zdjęcia bez atrybutu TITLE 134
Korzystanie Obraz ALT i TITLE atrybutu dla każdego obrazu.

Zdjęcia bez atrybutu TITLE

http://b.scorecardresearch.com/p?c1=2&c2=6036484&cv=2.0&cj=1
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/thumb/msid-55875957,width-332,resizemode-4/55875957.jpg
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/16657162.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/35958799.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/35958799.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
http://www.91-img.com/pictures/lenovo-phab-2-plus-mobile-phone-large-1.jpg
http://www.91-img.com/pictures/gionee-p7-max-mobile-phone-large-1.jpg
http://www.91-img.com/pictures/asus-zenfone-3-ultra-mobile-phone-large-1.jpg
http://www.91-img.com/pictures/blackberry-dtek50-mobile-phone-large-1.jpg
http://www.91-img.com/pictures/vivo-v5-mobile-phone-large-1.jpg
/photo/34824568.cms
/photo/35958799.cms
/photo/34824568.cms
/photo/20259450.cms
/photo/34824568.cms
/photo/35958799.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/35958799.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/35958799.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/50686029.cms
/photo/50686029.cms
/photo/50686029.cms
/photo/50686029.cms
/photo/34824568.cms
/photo/35958799.cms
/photo/53824389.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
http://ad.doubleclick.net/n7176/ad/toi_test/toi_test_1x1;sz=1x1;ord=[timestamp]?

Zdjęcia bez atrybutu ALT

http://b.scorecardresearch.com/p?c1=2&c2=6036484&cv=2.0&cj=1
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/16657162.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/20259450.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/35958799.cms
/photo/50686029.cms
/photo/50686029.cms
/photo/50686029.cms
/photo/50686029.cms
/photo/35958799.cms
/photo/53824389.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
/photo/34824568.cms
http://ad.doubleclick.net/n7176/ad/toi_test/toi_test_1x1;sz=1x1;ord=[timestamp]?

Ranking:


Alexa Traffic
Daily Global Rank Trend
Daily Reach (Percent)









Majestic SEO











Text on page:

: hi, my timeslogoutsign inmore more beauty pageantsphotosvideosmore fashionspecialsdebatephotosvideosplatinumtimes of indiamorehomehomevideosvideosnewsentertainmentcelebsmovieslifestylesportstechbusinessautofunnycitymetro citiesmumbaidelhibangalorehyderabadkolkatachennaiother citiesagartalaagraahmedabadallahabadamritsaraurangabadbareillybhopalbhubaneswarchandigarhcoimbatorecuttackdehradunerodefaridabadgoagurgaonguwahatihubliimphalindorejaipurjammujamshedpurjindkanpurkochikolhapurkozhikodelucknowludhianamaduraimangaloremeerutmysorenagpurnashiknavi mumbainoidapatnapuducherrypuneraipurrajahmundryrajkotranchisrinagarsalemshillongshimlasuratthanetrichythiruvananthapuramvadodaravaranasivisakhapatnamindiaworldworlduspakistansouth asiaukeuropechinamiddle eastnew to canadarest of worldmad, mad worldphotosvideosfollow world businessbusinessindia businessinternational businessmarketsphotosvideosfollow business techtech newsgadgetsreviewsslideshowsvideoshow tofeaturedfollow technology cricketcricketnewsresultsfixturescolumnsphotoslive cricket scorefollow cricbuzz sportssportsiplcricketfootballtennishockeygolfracingnbasflbadmintonboxingchesssouth africa in indiamore sportsother sportsphotosvideosfollow sports entertainmententertainmenthindienglishtamiltelugumalayalamkannadabengalipunjabimarathibhojpurigujaratimovie reviewsmusicbeauty pageantsphotosvideosfollow entertainment tvtv newsnewstrade newstv listingsmovies on tvspecialsphotosvideoshindienglishtamiltelugumalayalamkannadamarathibengaligujaratilife & stylelife & stylerelationshipshealth & fitnesslisten to your sugarbeautyspotlightfoodbookshome & gardenfashionevery heart countshomeopathyphotosvideosfollow life & style blogsphotosphotosmoviescelebsfashionbeauty pageantsawardseventstvsportsgadgetsnewsfollow photos epapertimes nowlive tvappscouponsall sectionsall cheap fuel, rupay card for villagers: govt announces big digital push top news stories use card, pay 0.75% less for petrol and diesel rs 90cr cash, 100kg gold seized from chennai jewellers pakistan plane crash: pia blames engine failure for god's sake, do your job: president to mps 4th test: india hit back after jennings century anti-left mamata slams govt for being 'capitalist' live blog: junior hockey wc - india vs canada entertainmentjayalalithaa's last journey: updates from chennaisharmila tagore on kareena's pregnancymovie review: la la landwatch: sanjay-maanayata return from dubaimeet the ‘uninvited guest’ at manish’s bashkjo's sweetest message for manish malhotramovie review: deepwater horizonwatch: priyanka releases ‘baywatch’ teaseranushka reacts on her dance video with virat big b unveils alankrita sahai's new albumbigg boss hotties of all times!hotties hooked up in 2016!time mag. person of the year 2016yuvraj, hazel's starry receptionranveer, vaani promote befikrecelebs who died in povertycho ramaswamy passes awaysportsmen and their posh homessonam dazzles in stunning dressmanish malhotra's b'day partyscreen awards: inside photoskriti sanon sizzles in backless attirenargis fakhri's bridal avatarcabaret dancer kisses ranveerspotted: anushka, virat at airportbb10: bani will not meet lopa after the showpics: indian idol judges to appear on tkssaamir khan to go solo in 'koffee with karan' watch latest videos tvtrailersentertainmentsportsnews i-t raids: rs 90 crore cash, 100kg gold seized parliament must not be disrupted: pranab 'women wearing churidars cannot enter temple' bipasha-karan act pricey for joint appearance hc says triple talaq is unconstitutional 'demonetisation is a foolish decision' kashmir: bank looted by terrorists one month of note ban: a reality check speeding car runs over pedestrians upset farmers throw tons of tomatoes on roads latest news no old notes for buses, metro, rail after dec 10 8 facebook tricks you must know delhi govt hikes guest teachers' salary by up to 90% talks with india should be result-oriented, says pak ruckus at jaipur art festival fire at patel nagar metro station note ban will empower the poor: pm eu launches legal case in volkswagen scandal case note ban: a month on, cash-crunch still continues three lashkar militants killed in kashmir gunfight 100 delhi-bound trains delayed due to fog sensex zooms 457 points, nifty tops 8,200 how to bring 500kg woman to mumbai for surgery beauty queens who died due to drug overdose has trump softened his stand on h1-b visas? airtel offers 'free unlimited calls' across india social humour: trump beats modi, twitter reacts no churidar at padmanabhaswamy temple: hc world bank cancels $100 million loan for pakistan this 'supersonic' train may be faster than flight the real inside story of tata - mistry breakup note ban a 'yagna' against graft: pm modi hyderabad techies provide support to chennaites no service tax on card transactions up to rs 2,000 from across the times of india this confirms, apple car is not dead3 budget led tvs you can buyreasons why you should drink coffee everydayjhanvi kapoor is the new golden girl of bollywoodbritish waxworks get christmas makeover!8 ways to perk up your moodbeauty queens who died due to drug overdosebenefits of putting vicks vaporub over garlic clove!this smartphone has a mammoth 10900mah battery6 natural foods that boost brain healthvideo news: all in one minute @ 10amet: online or offline, iphone may cost the same hottest royal women smoking hot suntanned celebs celebs in nightwear bold bollywood debuts! hottest bikini trends hottest tv actresses featured today5 fears that diabetics haveshould you refrigerate eggs?nail art for christmas timetips to boost winter immunityfriends to keep away from your manexotic twists for home gardens more »entertainmenthindi1081479906english27135489tamil27135454telugu27135440malayalam27135428kannada27135414bengali27135398marathi27134572gujarati29982848hindi moviesthis actress wants to take acting tips from kangana ranautmeghna gulzar's next based on an espionage thrillerkaran johar: everything said by celebs shouldn't be‘kahaani 2’ box-office collection day 5pic: katrina, arpita share some sister-loveanushka: i know what soldiers go throughhindi reviewsaasra movie reviewkahaani 2: durga rani singh movie reviewmoh maya money movie reviewhindi tvaamir khan to go solo in 'koffee with karan'ye hai mohabbatein update: mani gets to know aboutwatch trailer: ducktales is coming back to your tvali asgar aka nani celebrates birthday on the setsamrita puri's personal connection with her reelranveer singh refuses to appear on comedy nightsin focus:rashami desainagarjunbigg bosshindi musichimesh reshammiya files for divorce fromanoushka shankar's refugee album vies formaharashtra government assures action inenglishjimmy kimmel to host oscars 2017angelina jolie wants children to remain close toreese witherspoon not allowed to talk to her sonmargaret whitton passes away at 67brad pitt, angelina jolie reach temporary custody'fantastic beasts' tops foreign box office withmovie reviews:la la land movie review | deepwater horizon movie revieweventsall citiesall cities2277129australian magician adam mada performs ink rosaiah, allu aravind attend dr srikantthe team of 'kahaani 2' hosts a privatesharmila tagore on kareena’s pregnancywatch: sanjay-maanayata return from dubaiwatch: kjo's sweetest message for manish malhotrabaadshaho: ajay devgn announces release datepics: virender sehwag, harbhajan singh at yuvrajpeter england mr. india 2016 webisode 2movie review: deepwater horizonpics: amitabh bachchan gets nostalgic onkatrina kaif looks mesmerising in this underwaterwatch: priyanka chopra teases fans with sneak peekpic: yuvraj singh-hazel keech’s glitzy weddingdharmendra’s unforgettable dialoguesranveer singh wants to get married and start ahrithik roshan and yami gautam's song ‘kaabil hoon’watch peter england mr india 2016 audition more » tech newsairtel offers free unlimited calls to anywhere in india6 tips to prevent smartphones from overheatinghere's all that india watched the most on youtube in the year 2016apple iphone tops flickr's 'most popular camera list'iit placements: amazon, paytm hire big reviewslenovo phab 2 plus review: too big for 'own good'gionee p7 max review: can be skippedlenovo ideapad miix 310 review: good for basic tasksaltec lansing zine 2.0: fails to impressasus zenfone 3 ultra review: good looks, decent performancelatestmobileslaptopstabletscamerastvspowerbankssmartwatchesacswashing m/csrefrigeratorsfitnessbandslenovo phab 2 pluscritic rating: 3/5gionee p7 maxcritic rating: 3/5asus zenfone 3 ultracritic rating: 3.5/5blackberry dtek50critic rating: 3.5/5vivo v5critic rating: 3.5/5 more »television highlightsare rashami, sidharth more than just co-stars?'nagarjun - ek yoddha' to end next monthbigg boss 10: know all about the shownew reality show to celebrate bollywood musici have zero knowledge about singing: karan joharmore »worldworldworld296589292us30359486pakistan30359534south asia3907412uk2177298europe1898274china1898184middle east1898272new to canada48281453rest of world671314mad, mad world2178430trump stacks top government posts with retiredkerry warns europe against 'authoritarian populism'manila says will not help us on patrols in southprobe launched into pak plane crash that killed 48trump picks 'old friend' of xi as us envoy to china more videos »photos/videosvideosphotostrending news entertainment celebs movie lifestyle sports tech business auto funnymost popular movies celebs fashion parties awards events sports gadgets news things you didn't know about jayalalithaaa timeline of jayalalithaa's life in film and politicsactor rajinikanth, dhanush pay homage to jayalalithaadeepika slays the no make-up look in this latest picturedharmendra remembers co-star jayalalithaasana khan wanted intimate scenes to be okayed in one takenation mourns jayalalithaa's demiserock on 2 poster: farhan akhtar, arjun rampal return with shraddha kapoorwatch: jayalalithaa's final journeyaiadmk workers mourn the passing away of jayalalithaarelated videos loading.. most shared most read most commented 1.amma no more: tamil nadu chief minister jayalalithaa dies2.likely for 'mothership of terror' comment, pm narendra modi beats donald trump, others in time's online 'person of the year' poll3.jayalalithaa: an icon's life in pictures4.virat kohli’s post supporting anushka sharma declared the ‘golden tweet’ of 2016 see all most shared stories loading.. see all most read stories loading.. see all most commented stories most popular‘a queue to end all queues’: pm narendra modi hard-sells demonetisation in moradabadnew notes worth rs 4.7 crore seized in i-t raids in bengaluruson has no legal right in parents' house, can stay at their mercy: delhi high courtthis is what gave qamar bajwa an edge in the race for pak army chief post, according to pak mediademonetisation: unaccounted deposits to attract 50% tax, 4 year lock-in perioddemonetisation tightens: no more exchange of rs 500 and rs 1000 notes, centre announcespic: adira's birth announcement cradle filled with goodies!rumoured 'dabangg 3' actress leaks topless pics for publicity?pic: abram kissed by two girls!pic: varun dhawan gearing up for underwater stuntspics: deepika padukone back on ‘xxx’ setswhat made hrithik run behind his son hrehaan?britain's daily mail eyeing yahoo bid: media reportsony cuts us prices for playstation 4 ahead of holiday seasonattrition at top level hurting e-commerce companies in india8 ways to go tree-less this christmas10 banned foods across the worldswaryog rules for healthy eatingkangana unhappy with hrithik for dragging rangoli into their battle?pic: arpita khan's maternity photoshootsonam kapoor speaks about her alleged love affairover 93 percent support for demonetisation in survey on pm narendra modi's appif saarc fails, there’s bimstec: india warns pakistanincriminating documents, rs 12 lakh cash seized during raids on zakir naik's ngo5 emotions and which body part they affect!exotic twists for home gardens this winteri am attracted to younger men. is it normal?azad's gift for aamir will melt your hearts!aamir khan - flashback to the future!sanjay dutt and salman khan end their friendship?8 uses of coffee maker no one told youvaginal problems you should be aware ofclever ideas to dress up your house for xmas partyflipkart announces next big billion sale’s dateswhat happens when iphone 6s is dipped in waterchandigarh man sells water pumps online, gets google ceo's praiselatest gadgetsintex aqua shine 4gmotorola moto g4 plusintex cloud famesamsung galaxy j7 (2016)zte v7acer liquid zest plusintex aqua g2asus zenfone go 4.5 2nd genphicomm clue 630huawei p9navbharat timescoupons & offersdeal of the day: upto 85% off on deals every hourflat rs. 7,000 off on apple iphone 6offer of the day: flat 40% cashback on travel dealscoupondunia exclusive: upto rs. 1000 cashback on domestic flflat 25% off on your first purchase (new users only)epaper: online replica of printread online replica of your favourite edition of toi anywhere.select your editionahmedabadbangalorechennaidelhihyderabadjaipurkolkatalucknowmumbaipunethe crest editionhow rich are you?obituaries / tributesmobile 58888nri solutionslive astrologyneed an answer? ask any of our renowned astrologers anytime, anywhere.free sms from pc to any mobilebest selling videos for your mobilelatest news on your mobilemore » more »citycitycity-2128932452mumbai-2128838597delhi-2128839596bangalore-2128833038hyderabad-2128816011kolkata-2128830821chennai2950623agartala48264339agra36768514ahmedabad-2128821153allahabad3947060amritsar48264748aurangabad17388722bareilly36768532bhopal10744190bhubaneswar4118235chandigarh-2128816762coimbatore7503091cuttack48264818dehradun36768551erode48264804faridabad48264319goa3012535gurgaon6547154guwahati4118215hubli3942695imphal48264476indore9644624jaipur3012544jammu48264118jamshedpur48264388jind48264530kanpur3947067kochi9710057kolhapur22778873kozhikode9710567lucknow-2128819658ludhiana3947051madurai9632514mangalore3942690meerut36768500mysore3942693nagpur442002nashik11459502navi mumbai22126655noida8021716patna-2128817995puducherry22777916pune-2128821991raipur17388717rajahmundry48264522rajkot3942663ranchi4118245srinagar48264138salem48263967shillong48264067shimla48264012surat3942660thane3831863trichy22778270thiruvananthapuram878156304vadodara3942666varanasi3947071visakhapatnam17388704smoke from metro coach at rajendra place, train withdrawndelhi govt increases salary of guest teachersthree decades after crime, postman to go to prisonlost mother for second time, rues gymnast saved bypali's bangar hospital set to go digital, 'will serve asmore »good newsdhrangadhra widow performs rituals at daughter's weddingair will now act as ‘navigator’ across 13 highwaysoon, there may be no booze shops on highwaysfree mri, ct scan for the poor in delhicountry-wide, varsities to go cashless life & stylemore »featured8 pictures that redefine motherhoodhe only talks about sex. helpegg alert! try these tests at home to find if your egg isbritish waxworks get christmas makeover!jhanvi kapoor is the new golden girl of bollywood, here'smore »health7 ways you are making your breakfast cereal unhealthyhave you ever accidentally peed while laughing?winter-proof your workoutmyths about pubic hair you don't have to believefoods to help you overcome acidity more »femina signs that you are commitment phobic 6 ways to revive tired face makeup 5 must-have shoes for your winter closet how technology can improve your sex life starters with a twist to wow your guests more »beauty pageantspeter england mr. india 2016 webisode 1rajasthan chief minister congratulates jitesh thakuramitabh bachchan unveils alankrita sahai's new albumbeauty queens who died due to drug overdosebeauty queens grieve for jayalalithaa more »traveltraveltravel30099030mysterious kutch11 stunning indian hotels you probably haven't stayed at but shouldpahalgam’s best budget bedstop beaches in indiaplaces near shimla that are perfect for weekend getawaysmore »spiritualitywomen of these 3 zodiac signs are perfect for marriage!career predictions 2017: will you be successful?gita jayanti on december 10: here's what you should do!meaning and interpretation of dreams in islamforecast 2017: luck or misfortune, what it would be? more »businessgovt has infused rs 23,993cr funds in ai: ministerrupee nears 1-month high, soars 27p to 67.36rbi may cut rates by up to 50 bps next year: reportno service tax on card transactions up to rs 2,000sensex rebounds 300 points, nifty above 8,200more »times news - radiotwo coaches of capital express derail, 34 injuredcho ramaswamy passes away at 82tn bids tearful farewell to 'amma' jayalalithaamamta flight: 6 pilots of three airlines groundedjayalalithaa buried next to mgr in marina beach more »sportssportssports4440091rio 2016530779ipl46780979cricket33187923football4719953tennis4719952hockey5802552golf4719950racing5802555nba8014655sfl12162843badminton3413169boxing3413166chess5802554south africa in india4719161more sports4719931off the field4719938toisasportsawards2015live blog: junior hockey world cup - india vs canada4th test: india hit back after jennings centurysachin tendulkar picks up stake in pbl franchisetalking points: reiffel cops a blow & cook's openingkashyap reaches quarter-finals at korea mastersmore »autocar sales edge up in novembers korea fines vw $32 mn for false advertisingmade in chennai: bmw's twin launches are 'desi'you won't believe what new merc headlights can dotrain carrying bmws derails, 97 vehicles damaged more »cricketashwin rattles england after jennings debut tonumpire paul reiffel suffers freak injurymathews, chandimal return for south africa tourgung-ho australia eye chappell-hadlee series sweepmaxwell in line for return in melbourne dead-rubbermohammad asghar called up as back-up for yasir shahlucknow could host matches in ipl 10getting ton in lahli was a turning point: panchalrahane ruled out, pandey named replacementaustralia name unchanged squad for brisbane testmanish pandey's time to 'be the hero' is here more »humoursocial humour: trump beats modi, twitter reactssocial humour: best raees memes on twitterman thinks he can still achieve new year resolutionssocial humour: jokes on salman's virginity back8 times when aadhar card makers got it wrongmore »real estatewill compensate buyers if property value falls, assureloans to be cheaper as rbi eases additional crr normpune metro rail project gets go-ahead from centrewho will inherit rs 90-crore poes garden bungalow?real estate industry reacts on unchanged key rates more »citizen reportercitycity53265631bangalorebangalorechennaichennaidelhidelhigurgaongurgaonhyderabadhyderabadkochikochikolkatakolkatamumbaimumbainoidanoidathiruvananthapuramthiruvananthapuramcops break traffic rulescommuters face dust as pwd sits on road worknumberplate violations are commondumpyard on dwarka road mediancarelessly put manhole lids a hazardmore »blogsafter jayalalithaa: panneerselvam is on uncharted terrain as cm of tamil naduins betwa accident highlights, once again, operational rot within navyamrit dhillon: closing of the liberal mind more »womenold pics of bollywood actressesgrunge make-up from celebritiesan interview with jeweller nirav modireal brides wear berry lips for their weddinghave a fling at your friend's wedding more »infographicscartoonshow tamil nadu grew despite jayalalithaa’s freebiesap, maharashtra take lead in e-wallet initiativesindia’s crude oil bill is down 50%, so consumption has risen 11%how demonetisation is beginning to hurt the economywallettrumpghajini'paneer' price in tnmore »complete coverageparliament session livepanneerselvamsasikala natarajandemonetisationnarendra modiindia canada hockey livecurrency demonetisationindia eng live scorecoffee with karan season 5mamata banerjeedeepwater horizon reviewdilip kumar hospitalisedkaabil hoon songraees trailerbefikrevirat kohli golden tweet more »sciencelonely cave dwelling bacteria resistant to 18 antibioticsheart disease protein linked to brain damage: studywhy getting old makes you happycancer treatment gets delayed in india: studyearth's days getting longer, slower: studymore »environmenttequila plant may be key to fighting droughtsgiraffes suffer 'silent extinction' in africasea ice in arctic and antarctic hit record lows regions around delhi contribute to its pollution: expertpolar bear numbers to plunge a third as sea ice melts more »sunday timesnow, kids join the everest racevoluntourists come in search of the real india, but lapnow we’re saying cheese, desi stylewealthy wives come out of the closetare you one of these notable types?more »nripio uk mp calls on india to end demonetisation stresscommunity newspaper 'india abroad' sold by rediffdemonetisation a huge cause of concern for nris, pios'british sikh woman honour killing victim in india'hindu groups call for 'non-veg' 5-pound note withdrawal more »speak outdo you think setting kra's for students and teachersis the maharashtra government really serious abouthas the bjp-led civic body let nagpur down?should private hospitals be asked to reserve 20% beds foris prohibition on liquor right or wrong, why?more »educationhrd to promote digital transactions among studentsdelhi government streamlines admission process for classasian countries dominate, science teaching criticised incollege principals to get one more term: ugc's new ruleparrikar bats for facilities to differently-abled access times of india news on the move!our new innovative apps deliver the speed, breadth and insight of times journalism in comprehensive news streams across different platforms.iphoneandroidblackberryipadwindows phonemore from our networkmore » zigwheels.com off-roading review: isuzu d-max v-cross how to prepare your car for the wintertvs apache rtr 200 4v- detailed revieweffect of demonetization on the auto industryexclusive - car loan emi calculatormore »the huffington post more »business insider indiamore »techradar india get quote marketnewsstay with dividend payers: 15 names to bet ontop 4 factors fuelling rally in sensex on thursdayrs 11.5l cr deposits! did rbi double-count new &sensexniftymore »learn at coursera more »gizmodo indiamore »mensxp more »itimesbigg boss' priyanka jagga's personal life!sunny leone's sexiest photosvirat-anushka like never before: picsb'day: dharmendra's unknown factsvote: times most desirable female-kolkatamore »lifehacker more »jobs7 communication tips to retain employeestravel & hospitality generated most jobs in nov5 signs that you will get promotion soon can micro-entrepreneurs resolve unemployment?is b-school placement culture healthy?more »indiatimes more »goalmore » filmfare sonakshi sinha and bunty sachdev party together movie review: mirzya randeep hooda and vidyut jammwal refuse sarkar... guess who was ranveer singh bonding with big... hrithik roshan, jacqueline fernandez, zoya... more »boxtvwatch echoes 2015 english movie onlinewatch alone 2015 hindi movie onlinewatch dirty politics 2015 hindi movie onlinewatch against the sun 2015 english movie...trailersmovieshindienglishtamiltelugu listen to music online freedangalpritamstarboykaabilrajesh roshanblack barbiesnicki minajbefikrevishal-shekhardarkness and light about usprivacy policynewslettersitemapcreate your own adadvertise with usfeedbacktoi mobileterms of use and grievance redressal policyrssepaperarchivesother times group news sitesthe economic times | इकनॉमिक टाइम्स | ઈકોનોમિક ટાઈમ્સ | pune mirror | bangalore mirror | ahmedabad mirror | itsmyascent | education times | brand capital | mumbai mirror | times now | indiatimes | नवभारत टाइम्स | महाराष्ट्र टाइम्स | ವಿಜಯ ಕರ್ನಾಟಕ | go green | lifehacker india | gizmodo india | eisamay | ign india | navgujarat samay | tamil news | telugu news | miss kyra | hindi news | filmipop hindiliving and entertainmentidiva | entertainment | zoom | luxpresso | mobile phones | online songs | mensxp.com | hotels | travel destinations | smartapp | cricbuzz.com | filmfare | femina | grazia | filmipop | bombay timesinterest networkitimeshot on the webcricket news | sunny leone bikini pics | how to get pregnant | latest newsservicesbook print ads | online shopping | matrimonial | astrology | jobs | tech community | property | buy car | bikes in india | deals | free classifieds | used cars | restaurants in delhi | movie show timings | remit to india | listen songs | timesmobile | real estate developers | restaurant deals in delhi | mobile recharge | bollywood news | bank exam app | itimes entertainment app | etmoney finance apptrending topicsbeauty care | recipes | movie reviews | weather today | google pixel price in india | iphone 7 plus review | diwali pooja 2016 | bigg boss 10follow us ontop trendsjayalalithabigg boss 10sasikala natarajancurrency demonetizationindia vs canada hockey livenew rs2000 noteindia england live scoreparliament session livecyclone in andamancopyright © 2016 bennett, coleman & co. ltd. all rights reserved. for reprint rights:times syndication service `


Here you find all texts from your page as Google (googlebot) and others search engines seen it.

Words density analysis:

Numbers of all words: 3150

One word

Two words phrases

Three words phrases

the - 2.03% (64)
more - 1.81% (57)
for - 1.81% (57)
new - 1.49% (47)
you - 1.4% (44)
india - 1.4% (44)
our - 1.37% (43)
one - 1.33% (42)
and - 1.24% (39)
are - 1.08% (34)
all - 0.98% (31)
time - 0.98% (31)
her - 0.95% (30)
hot - 0.92% (29)
news - 0.92% (29)
end - 0.79% (25)
times - 0.76% (24)
get - 0.76% (24)
art - 0.76% (24)
movie - 0.76% (24)
review - 0.73% (23)
man - 0.73% (23)
ban - 0.73% (23)
out - 0.67% (21)
your - 0.67% (21)
act - 0.67% (21)
with - 0.67% (21)
son - 0.63% (20)
video - 0.6% (19)
car - 0.57% (18)
can - 0.57% (18)
eng - 0.57% (18)
app - 0.54% (17)
photos - 0.54% (17)
videos - 0.54% (17)
off - 0.54% (17)
now - 0.54% (17)
line - 0.54% (17)
watch - 0.51% (16)
not - 0.51% (16)
over - 0.51% (16)
sports - 0.51% (16)
jayalalithaa - 0.48% (15)
from - 0.44% (14)
old - 0.44% (14)
delhi - 0.44% (14)
world - 0.41% (13)
day - 0.41% (13)
how - 0.41% (13)
his - 0.41% (13)
enter - 0.38% (12)
most - 0.38% (12)
hindi - 0.38% (12)
ice - 0.38% (12)
use - 0.38% (12)
life - 0.38% (12)
top - 0.38% (12)
big - 0.38% (12)
live - 0.38% (12)
online - 0.35% (11)
know - 0.35% (11)
entertainment - 0.35% (11)
2016 - 0.35% (11)
back - 0.35% (11)
demonetisation - 0.32% (10)
tech - 0.32% (10)
led - 0.32% (10)
mad - 0.32% (10)
real - 0.32% (10)
beauty - 0.32% (10)
will - 0.32% (10)
this - 0.29% (9)
review: - 0.29% (9)
chennai - 0.29% (9)
business - 0.29% (9)
here - 0.29% (9)
about - 0.29% (9)
note - 0.29% (9)
gets - 0.29% (9)
pak - 0.29% (9)
mobile - 0.29% (9)
mumbai - 0.29% (9)
pics - 0.29% (9)
ever - 0.25% (8)
should - 0.25% (8)
rail - 0.25% (8)
set - 0.25% (8)
home - 0.25% (8)
celebs - 0.25% (8)
that - 0.25% (8)
ways - 0.25% (8)
has - 0.25% (8)
modi - 0.25% (8)
its - 0.25% (8)
may - 0.25% (8)
water - 0.25% (8)
key - 0.25% (8)
tamil - 0.25% (8)
free - 0.22% (7)
light - 0.22% (7)
let - 0.22% (7)
vies - 0.22% (7)
year - 0.22% (7)
mani - 0.22% (7)
cricket - 0.22% (7)
100 - 0.22% (7)
what - 0.22% (7)
show - 0.22% (7)
cash - 0.22% (7)
english - 0.22% (7)
trump - 0.22% (7)
style - 0.22% (7)
have - 0.22% (7)
own - 0.22% (7)
ton - 0.22% (7)
sex - 0.22% (7)
after - 0.22% (7)
land - 0.22% (7)
latest - 0.22% (7)
but - 0.19% (6)
away - 0.19% (6)
sun - 0.19% (6)
gold - 0.19% (6)
bollywood - 0.19% (6)
high - 0.19% (6)
reviews - 0.19% (6)
sea - 0.19% (6)
bangalore - 0.19% (6)
iphone - 0.19% (6)
hockey - 0.19% (6)
poor - 0.19% (6)
movies - 0.19% (6)
canada - 0.19% (6)
south - 0.19% (6)
karan - 0.19% (6)
ign - 0.19% (6)
dec - 0.19% (6)
any - 0.19% (6)
who - 0.19% (6)
travel - 0.19% (6)
post - 0.19% (6)
bigg - 0.19% (6)
hyderabad - 0.19% (6)
less - 0.19% (6)
singh - 0.19% (6)
boss - 0.19% (6)
khan - 0.19% (6)
try - 0.16% (5)
tvs - 0.16% (5)
run - 0.16% (5)
than - 0.16% (5)
road - 0.16% (5)
rating: - 0.16% (5)
right - 0.16% (5)
anushka - 0.16% (5)
luck - 0.16% (5)
emi - 0.16% (5)
england - 0.16% (5)
plus - 0.16% (5)
film - 0.16% (5)
next - 0.16% (5)
ink - 0.16% (5)
part - 0.16% (5)
call - 0.16% (5)
good - 0.16% (5)
box - 0.16% (5)
winter - 0.16% (5)
200 - 0.16% (5)
pune - 0.16% (5)
virat - 0.16% (5)
ranveer - 0.16% (5)
return - 0.16% (5)
pakistan - 0.16% (5)
pay - 0.16% (5)
person - 0.16% (5)
metro - 0.16% (5)
nagar - 0.16% (5)
card - 0.16% (5)
across - 0.16% (5)
telugu - 0.16% (5)
their - 0.16% (5)
2015 - 0.16% (5)
manish - 0.16% (5)
govt - 0.16% (5)
guest - 0.13% (4)
talk - 0.13% (4)
aamir - 0.13% (4)
cut - 0.13% (4)
action - 0.13% (4)
government - 0.13% (4)
mirror - 0.13% (4)
eases - 0.13% (4)
jaipur - 0.13% (4)
rbi - 0.13% (4)
music - 0.13% (4)
hit - 0.13% (4)
tips - 0.13% (4)
garden - 0.13% (4)
come - 0.13% (4)
horizon - 0.13% (4)
read - 0.13% (4)
auto - 0.13% (4)
into - 0.13% (4)
fashion - 0.13% (4)
awards - 0.13% (4)
gadgets - 0.13% (4)
jayalalithaa's - 0.13% (4)
died - 0.13% (4)
wedding - 0.13% (4)
max - 0.13% (4)
month - 0.13% (4)
narendra - 0.13% (4)
reacts - 0.13% (4)
deepwater - 0.13% (4)
song - 0.13% (4)
ahmedabad - 0.13% (4)
two - 0.13% (4)
deals - 0.13% (4)
hrithik - 0.13% (4)
bank - 0.13% (4)
take - 0.13% (4)
hai - 0.13% (4)
actress - 0.13% (4)
women - 0.13% (4)
train - 0.13% (4)
humour: - 0.13% (4)
social - 0.13% (4)
africa - 0.13% (4)
indiamore - 0.13% (4)
service - 0.13% (4)
announces - 0.13% (4)
kapoor - 0.13% (4)
every - 0.13% (4)
queens - 0.13% (4)
christmas - 0.13% (4)
stories - 0.13% (4)
hospital - 0.13% (4)
tops - 0.13% (4)
golden - 0.13% (4)
sensex - 0.13% (4)
seized - 0.13% (4)
ipl - 0.13% (4)
due - 0.13% (4)
price - 0.13% (4)
love - 0.1% (3)
maharashtra - 0.1% (3)
heart - 0.1% (3)
minister - 0.1% (3)
chief - 0.1% (3)
nadu - 0.1% (3)
peed - 0.1% (3)
signs - 0.1% (3)
berry - 0.1% (3)
face - 0.1% (3)
buy - 0.1% (3)
loading.. - 0.1% (3)
jennings - 0.1% (3)
arjun - 0.1% (3)
egg - 0.1% (3)
look - 0.1% (3)
twist - 0.1% (3)
flat - 0.1% (3)
name - 0.1% (3)
best - 0.1% (3)
day: - 0.1% (3)
events - 0.1% (3)
shimla - 0.1% (3)
was - 0.1% (3)
capital - 0.1% (3)
here's - 0.1% (3)
wear - 0.1% (3)
priyanka - 0.1% (3)
itimes - 0.1% (3)
serve - 0.1% (3)
care - 0.1% (3)
healthy - 0.1% (3)
ads - 0.1% (3)
break - 0.1% (3)
mother - 0.1% (3)
dress - 0.1% (3)
estate - 0.1% (3)
media - 0.1% (3)
china - 0.1% (3)
rich - 0.1% (3)
print - 0.1% (3)
dust - 0.1% (3)
see - 0.1% (3)
sits - 0.1% (3)
digital - 0.1% (3)
toi - 0.1% (3)
edition - 0.1% (3)
500 - 0.1% (3)
australia - 0.1% (3)
edge - 0.1% (3)
stay - 0.1% (3)
ask - 0.1% (3)
merc - 0.1% (3)
uses - 0.1% (3)
these - 0.1% (3)
raids - 0.1% (3)
twitter - 0.1% (3)
टाइम्स - 0.1% (3)
notes - 0.1% (3)
party - 0.1% (3)
wants - 0.1% (3)
drug - 0.1% (3)
crore - 0.1% (3)
why - 0.1% (3)
coffee - 0.1% (3)
girl - 0.1% (3)
parliament - 0.1% (3)
desi - 0.1% (3)
must - 0.1% (3)
says - 0.1% (3)
adam - 0.1% (3)
foods - 0.1% (3)
bet - 0.1% (3)
apple - 0.1% (3)
close - 0.1% (3)
nifty - 0.1% (3)
hottest - 0.1% (3)
nagpur - 0.1% (3)
host - 0.1% (3)
onlinewatch - 0.1% (3)
album - 0.1% (3)
rates - 0.1% (3)
featured - 0.1% (3)
share - 0.1% (3)
three - 0.1% (3)
case - 0.1% (3)
listen - 0.1% (3)
on, - 0.1% (3)
yuvraj - 0.1% (3)
overdose - 0.1% (3)
roshan - 0.1% (3)
support - 0.1% (3)
help - 0.1% (3)
europe - 0.1% (3)
loan - 0.1% (3)
placement - 0.1% (3)
beats - 0.1% (3)
10: - 0.1% (3)
jobs - 0.1% (3)
passes - 0.1% (3)
against - 0.1% (3)
3.5/5 - 0.1% (3)
peter - 0.1% (3)
inside - 0.1% (3)
getting - 0.1% (3)
zenfone - 0.1% (3)
popular - 0.1% (3)
offers - 0.1% (3)
appear - 0.1% (3)
anywhere - 0.1% (3)
calls - 0.1% (3)
tax - 0.1% (3)
transactions - 0.1% (3)
korea - 0.06% (2)
beach - 0.06% (2)
300 - 0.06% (2)
today - 0.06% (2)
different - 0.06% (2)
like - 0.06% (2)
restaurant - 0.06% (2)
never - 0.06% (2)
politics - 0.06% (2)
reiffel - 0.06% (2)
demonetization - 0.06% (2)
debut - 0.06% (2)
»business - 0.06% (2)
believe - 0.06% (2)
cops - 0.06% (2)
did - 0.06% (2)
filmfare - 0.06% (2)
refuse - 0.06% (2)
eye - 0.06% (2)
ontop - 0.06% (2)
apps - 0.06% (2)
session - 0.06% (2)
cars - 0.06% (2)
gizmodo - 0.06% (2)
mind - 0.06% (2)
femina - 0.06% (2)
arctic - 0.06% (2)
education - 0.06% (2)
jeweller - 0.06% (2)
indiatimes - 0.06% (2)
songs - 0.06% (2)
lifehacker - 0.06% (2)
suffer - 0.06% (2)
tweet - 0.06% (2)
once - 0.06% (2)
samay - 0.06% (2)
bill - 0.06% (2)
down - 0.06% (2)
hurt - 0.06% (2)
phones - 0.06% (2)
kohli - 0.06% (2)
miss - 0.06% (2)
hoon - 0.06% (2)
zoom - 0.06% (2)
soon - 0.06% (2)
rot - 0.06% (2)
accident - 0.06% (2)
pandey - 0.06% (2)
filmipop - 0.06% (2)
science - 0.06% (2)
unchanged - 0.06% (2)
used - 0.06% (2)
beds - 0.06% (2)
raees - 0.06% (2)
property - 0.06% (2)
reserve - 0.06% (2)
group - 0.06% (2)
private - 0.06% (2)
community - 0.06% (2)
panneerselvam - 0.06% (2)
industry - 0.06% (2)
astrology - 0.06% (2)
students - 0.06% (2)
think - 0.06% (2)
sold - 0.06% (2)
leone - 0.06% (2)
join - 0.06% (2)
sunny - 0.06% (2)
put - 0.06% (2)
jayalalithaa: - 0.06% (2)
season - 0.06% (2)
ultra - 0.06% (2)
ai: - 0.06% (2)
unlimited - 0.06% (2)
talks - 0.06% (2)
station - 0.06% (2)
launches - 0.06% (2)
legal - 0.06% (2)
still - 0.06% (2)
killed - 0.06% (2)
kashmir - 0.06% (2)
delayed - 0.06% (2)
fog - 0.06% (2)
457 - 0.06% (2)
points, - 0.06% (2)
8,200 - 0.06% (2)
woman - 0.06% (2)
airtel - 0.06% (2)
modi, - 0.06% (2)
reality - 0.06% (2)
bikini - 0.06% (2)
arpita - 0.06% (2)
kangana - 0.06% (2)
gardens - 0.06% (2)
twists - 0.06% (2)
actresses - 0.06% (2)
trends - 0.06% (2)
brain - 0.06% (2)
churidar - 0.06% (2)
boost - 0.06% (2)
smartphone - 0.06% (2)
waxworks - 0.06% (2)
budget - 0.06% (2)
2,000 - 0.06% (2)
flight - 0.06% (2)
salary - 0.06% (2)
ban: - 0.06% (2)
personal - 0.06% (2)
sanjay-maanayata - 0.06% (2)
technology - 0.06% (2)
cricbuzz - 0.06% (2)
cheap - 0.06% (2)
cash, - 0.06% (2)
100kg - 0.06% (2)
plane - 0.06% (2)
mps - 0.06% (2)
4th - 0.06% (2)
test: - 0.06% (2)
century - 0.06% (2)
mamata - 0.06% (2)
blog: - 0.06% (2)
junior - 0.06% (2)
tagore - 0.06% (2)
sweetest - 0.06% (2)
i-t - 0.06% (2)
stunning - 0.06% (2)
karan' - 0.06% (2)
'koffee - 0.06% (2)
solo - 0.06% (2)
indian - 0.06% (2)
meet - 0.06% (2)
b'day - 0.06% (2)
ramaswamy - 0.06% (2)
message - 0.06% (2)
promote - 0.06% (2)
hotties - 0.06% (2)
sahai's - 0.06% (2)
alankrita - 0.06% (2)
unveils - 0.06% (2)
dance - 0.06% (2)
money - 0.06% (2)
jolie - 0.06% (2)
2017: - 0.06% (2)
moto - 0.06% (2)
underwater - 0.06% (2)
deepika - 0.06% (2)
made - 0.06% (2)
ahead - 0.06% (2)
rules - 0.06% (2)
body - 0.06% (2)
melt - 0.06% (2)
salman - 0.06% (2)
maker - 0.06% (2)
house - 0.06% (2)
when - 0.06% (2)
sells - 0.06% (2)
google - 0.06% (2)
aqua - 0.06% (2)
plusintex - 0.06% (2)
centre - 0.06% (2)
pictures - 0.06% (2)
perfect - 0.06% (2)
near - 0.06% (2)
hotels - 0.06% (2)
closet - 0.06% (2)
tired - 0.06% (2)
only - 0.06% (2)
scan - 0.06% (2)
upto - 0.06% (2)
there - 0.06% (2)
time, - 0.06% (2)
coach - 0.06% (2)
replica - 0.06% (2)
cashback - 0.06% (2)
rs. - 0.06% (2)
birth - 0.06% (2)
1000 - 0.06% (2)
angelina - 0.06% (2)
amitabh - 0.06% (2)
too - 0.06% (2)
phab - 0.06% (2)
camera - 0.06% (2)
start - 0.06% (2)
looks - 0.06% (2)
bachchan - 0.06% (2)
webisode - 0.06% (2)
celebrate - 0.06% (2)
mr. - 0.06% (2)
release - 0.06% (2)
kjo's - 0.06% (2)
performs - 0.06% (2)
office - 0.06% (2)
reach - 0.06% (2)
fails - 0.06% (2)
warns - 0.06% (2)
50% - 0.06% (2)
shared - 0.06% (2)
attract - 0.06% (2)
deposits - 0.06% (2)
race - 0.06% (2)
queue - 0.06% (2)
others - 0.06% (2)
commented - 0.06% (2)
mourn - 0.06% (2)
crash - 0.06% (2)
final - 0.06% (2)
co-star - 0.06% (2)
make-up - 0.06% (2)
lifestyle - 0.06% (2)
friend' - 0.06% (2)
picks - 0.06% (2)
rights - 0.06% (2)
more » - 1.43% (45)
of the - 0.29% (9)
india | - 0.19% (6)
how to - 0.16% (5)
news | - 0.16% (5)
social humour: - 0.13% (4)
due to - 0.13% (4)
note ban - 0.13% (4)
movie review: - 0.13% (4)
deepwater horizon - 0.13% (4)
who died - 0.13% (4)
mirror | - 0.13% (4)
life & - 0.13% (4)
on the - 0.13% (4)
narendra modi - 0.13% (4)
& style - 0.13% (4)
peter england - 0.1% (3)
ice in - 0.1% (3)
of india - 0.1% (3)
you should - 0.1% (3)
back on - 0.1% (3)
is the - 0.1% (3)
see all - 0.1% (3)
pm narendra - 0.1% (3)
tips to - 0.1% (3)
ways to - 0.1% (3)
of bollywood - 0.1% (3)
passes away - 0.1% (3)
tamil nadu - 0.1% (3)
india 2016 - 0.1% (3)
off on - 0.1% (3)
to get - 0.1% (3)
in the - 0.1% (3)
to end - 0.1% (3)
with karan - 0.1% (3)
may be - 0.1% (3)
movie reviews - 0.1% (3)
times of - 0.1% (3)
टाइम्स | - 0.1% (3)
hindi movie - 0.1% (3)
movie onlinewatch - 0.1% (3)
after jennings - 0.1% (3)
india vs - 0.1% (3)
died due - 0.1% (3)
for the - 0.1% (3)
queens who - 0.1% (3)
to drug - 0.1% (3)
up for - 0.06% (2)
replica of - 0.06% (2)
| mobile - 0.06% (2)
demonetisation in - 0.06% (2)
sunny leone - 0.06% (2)
i-t raids - 0.06% (2)
on your - 0.06% (2)
the day: - 0.06% (2)
cashback on - 0.06% (2)
plus review - 0.06% (2)
apple iphone - 0.06% (2)
for home - 0.06% (2)
samay | - 0.06% (2)
| online - 0.06% (2)
delhi | - 0.06% (2)
| restaurant - 0.06% (2)
across the - 0.06% (2)
signs that - 0.06% (2)
for your - 0.06% (2)
away at - 0.06% (2)
maharashtra government - 0.06% (2)
the real - 0.06% (2)
that you - 0.06% (2)
price in - 0.06% (2)
2015 english - 0.06% (2)
back after - 0.06% (2)
india hit - 0.06% (2)
blog: junior - 0.06% (2)
transactions up - 0.06% (2)
the poor - 0.06% (2)
on card - 0.06% (2)
service tax - 0.06% (2)
perfect for - 0.06% (2)
of these - 0.06% (2)
are perfect - 0.06% (2)
england mr. - 0.06% (2)
you are - 0.06% (2)
| times - 0.06% (2)
africa in - 0.06% (2)
will not - 0.06% (2)
most commented - 0.06% (2)
appear on - 0.06% (2)
new golden - 0.06% (2)
rs 2,000 - 0.06% (2)
card transactions - 0.06% (2)
tax on - 0.06% (2)
no service - 0.06% (2)
modi, twitter - 0.06% (2)
trump beats - 0.06% (2)
points, nifty - 0.06% (2)
should be - 0.06% (2)
ban: a - 0.06% (2)
'koffee with - 0.06% (2)
solo in - 0.06% (2)
ramaswamy passes - 0.06% (2)
get christmas - 0.06% (2)
sahai's new - 0.06% (2)
unveils alankrita - 0.06% (2)
review: deepwater - 0.06% (2)
message for - 0.06% (2)
return from - 0.06% (2)
junior hockey - 0.06% (2)
live blog: - 0.06% (2)
hit back - 0.06% (2)
test: india - 0.06% (2)
from chennai - 0.06% (2)
gold seized - 0.06% (2)
cash, 100kg - 0.06% (2)
girl of - 0.06% (2)
up your - 0.06% (2)
most read - 0.06% (2)
amitabh bachchan - 0.06% (2)
stories loading.. - 0.06% (2)
most shared - 0.06% (2)
chief minister - 0.06% (2)
in one - 0.06% (2)
life in - 0.06% (2)
know about - 0.06% (2)
to your - 0.06% (2)
zenfone 3 - 0.06% (2)
p7 max - 0.06% (2)
2 plus - 0.06% (2)
unlimited calls - 0.06% (2)
in this - 0.06% (2)
2016 webisode - 0.06% (2)
twists for - 0.06% (2)
mr. india - 0.06% (2)
kjo's sweetest - 0.06% (2)
sanjay-maanayata return - 0.06% (2)
tagore on - 0.06% (2)
review | - 0.06% (2)
to appear - 0.06% (2)
back to - 0.06% (2)
in 'koffee - 0.06% (2)
go solo - 0.06% (2)
khan to - 0.06% (2)
wants to - 0.06% (2)
home gardens - 0.06% (2)
canada hockey - 0.06% (2)
queens who died - 0.1% (3)
to drug overdose - 0.1% (3)
india vs canada - 0.1% (3)
pm narendra modi - 0.1% (3)
due to drug - 0.1% (3)
who died due - 0.1% (3)
to appear on - 0.06% (2)
india 2016 webisode - 0.06% (2)
phab 2 plus - 0.06% (2)
loading.. see all - 0.06% (2)
online replica of - 0.06% (2)
4th test: india - 0.06% (2)
golden girl of - 0.06% (2)
england mr. india - 0.06% (2)
india hit back - 0.06% (2)
humour: trump beats - 0.06% (2)
2015 english movie - 0.06% (2)
hindi movie onlinewatch - 0.06% (2)
is the new - 0.06% (2)
new golden girl - 0.06% (2)
for home gardens - 0.06% (2)
hit back after - 0.06% (2)
kapoor is the - 0.06% (2)
transactions up to - 0.06% (2)
tax on card - 0.06% (2)
beats modi, twitter - 0.06% (2)
social humour: trump - 0.06% (2)
note ban: a - 0.06% (2)
in 'koffee with - 0.06% (2)
to go solo - 0.06% (2)
person of the - 0.06% (2)
unveils alankrita sahai's - 0.06% (2)
sweetest message for - 0.06% (2)
live blog: junior - 0.06% (2)
in india | - 0.06% (2)

Here you can find chart of all your popular one, two and three word phrases. Google and others search engines means your page is about words you use frequently.

Copyright © 2015-2016 hupso.pl. All rights reserved. FB | +G | Twitter

Hupso.pl jest serwisem internetowym, w którym jednym kliknieciem możesz szybko i łatwo sprawdź stronę www pod kątem SEO. Oferujemy darmowe pozycjonowanie stron internetowych oraz wycena domen i stron internetowych. Prowadzimy ranking polskich stron internetowych oraz ranking stron alexa.