2.36 score from hupso.pl for:
security-portal.cz



HTML Content


Titlesecurity-portal.cz | bezpečnost • hacking • komunita

Length: 52, Words: 6
Description pusty

Length: 0, Words: 0
Keywords pusty
Robots
Charset UTF-8
Og Meta - Title pusty
Og Meta - Description pusty
Og Meta - Site name pusty
Tytuł powinien zawierać pomiędzy 10 a 70 znaków (ze spacjami), a mniej niż 12 słów w długości.
Meta opis powinien zawierać pomiędzy 50 a 160 znaków (łącznie ze spacjami), a mniej niż 24 słów w długości.
Kodowanie znaków powinny być określone , UTF-8 jest chyba najlepszy zestaw znaków, aby przejść z powodu UTF-8 jest bardziej międzynarodowy kodowaniem.
Otwarte obiekty wykresu powinny być obecne w stronie internetowej (więcej informacji na temat protokołu OpenGraph: http://ogp.me/)

SEO Content

Words/Characters 2063
Text/HTML 23.63 %
Headings H1 1
H2 20
H3 20
H4 0
H5 0
H6 0
H1
kategorie
H2


menu
dnešní oblíbený obsah
aktuality
nejnovější příspěvky blogu

navigace
náhodný obsah
tagy
rss feed
přihlášení
poslední komentáře
konference
doporučujeme
gnu/linux & bsd
it news
security vulnerabilities & exploits

H3
cissp history
zeus variant ‘floki bot’ targets pos data
buffer overflow in bsd libc library patched
news in brief: dirtycow patched for android; naked lack of security; south korea hacked
hacker who stole celebrity emails, sex tapes, movie scripts gets 5 years in prison
charities hit with fines for sharing donors’ data without consent
5-year-old linux kernel local privilege escalation flaw discovered
v bezpečnostních ip kamerách sony byla nalezena „zadní vrátka“, umožnila administrátorský přístup komukoli
critical vulnerability patched in roundcube webmail
zombie routery chystaly útok v německu a británii, stejný vir dříve odstavil twitter
flaw spotted in north korea’s red star operating system
nintendo targets 3ds vulnerabilities in new bug bounty
5 benefits of cloud-based end-point security products
denial of service attack
hackers gamify ddos attacks with collaborative platform
where cybercriminals go to buy your stolen data
blacknurse low-volume dos attack targets firewalls
north korea's linux-based red star os can be hacked remotely with just a link
hacking millions with just an image — recipe: pixels, ads & exploit kit
millions exposed to malvertising that hid attack code in banner pixels
H4
H5
H6
strong
security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech.
b
security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech.
i
em security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech.
Bolds strong 1
b 1
i 0
em 1
Zawartość strony internetowej powinno zawierać więcej niż 250 słów, z stopa tekst / kod jest wyższy niż 20%.
Pozycji używać znaczników (h1, h2, h3, ...), aby określić temat sekcji lub ustępów na stronie, ale zwykle, użyj mniej niż 6 dla każdego tagu pozycje zachować swoją stronę zwięzły.
Styl używać silnych i kursywy znaczniki podkreślić swoje słowa kluczowe swojej stronie, ale nie nadużywać (mniej niż 16 silnych tagi i 16 znaczników kursywy)

Statystyki strony

twitter:title pusty
twitter:description pusty
google+ itemprop=name pusty
Pliki zewnętrzne 8
Pliki CSS 2
Pliki javascript 6
Plik należy zmniejszyć całkowite odwołanie plików (CSS + JavaScript) do 7-8 maksymalnie.

Linki wewnętrzne i zewnętrzne

Linki 256
Linki wewnętrzne 158
Linki zewnętrzne 98
Linki bez atrybutu Title 159
Linki z atrybutem NOFOLLOW 0
Linki - Użyj atrybutu tytuł dla każdego łącza. Nofollow link jest link, który nie pozwala wyszukiwarkom boty zrealizują są odnośniki no follow. Należy zwracać uwagę na ich użytkowania

Linki wewnętrzne

- /
home /
články /node
projekty /page/projekty
hackerspace v čr /page/hackerspace-laby-v-%c4%8desk%c3%a9-republice
služby /page/slu%c5%beby-security-portalcz
security-portal.cz trička /clanky/tri%c4%8dka-security-portalcz
password generator /page/password-generator
wallpapery /category/galerie/wallpapery
konference a výstavy /page/konference-v%c3%bdstavy
virové zpravodajství /page/virov%c3%a9-zpravodajstv%c3%ad
hacking filmy /page/hacking-filmy
literatura /page/literatura-e-learning
filozofie serveru /page/filozofie-serveru-security-portalcz
přidejte se k nám! /page/p%c5%99idejte-se-k-n%c3%a1m
podpořte nás! /page/podpo%c5%99te-n%c3%a1s
rady pro psaní /filter/tips
autoři serveru /page/auto%c5%99i-serveru
mapa webu /sitemap
kontakt & irc /page/kontaktn%c3%ad-informace
analýza cíleného útoku, část první /clanky/anal%c3%bdza-c%c3%adlen%c3%a9ho-%c3%batoku-%c4%8d%c3%a1st-prvn%c3%ad
kybernetický zákon – téma pro it security workshop /kyberneticky-zakon-tema-pro-it-security-workshop
kontaktní informace /page/kontaktn%c3%ad-informace
google hacking... (profesionalne) /clanky/google-hacking-profesionalne
rozdělování ip sítí /clanky/rozd%c4%9blov%c3%a1n%c3%ad-ip-s%c3%adt%c3%ad
filozofie serveru security-portal.cz /page/filozofie-serveru-security-portalcz
další /popular/today
další /aggregator/categories/1
upřímní rapeři byli zatčeni za carding /node/3762
anonymous odcizili osobní údaje 5400 španělských policistů /node/3761
cena uniklých dat: linkedin, thumblr, myspace /node/3760
uk: ztracené peníze z vašeho bankovního účtu? no, je to vaše vina /node/3759
cryptxxx znovu aktualizován, doposud žádné dešifrování ani po zaplacení výkupného /node/3758
další /rss-blog.xml
- javascript:dogtranslate('cs|cs')
- javascript:dogtranslate('cs|en')
- javascript:dogtranslate('cs|fr')
- javascript:dogtranslate('cs|de')
- javascript:dogtranslate('cs|it')
- javascript:dogtranslate('cs|ru')
- javascript:dogtranslate('cs|es')
blogy /blog
obrázky /image
poslední příspěvky /tracker
oblíbený obsah /popular
agregátor rss /aggregator
kategorie /aggregator/categories
aktuality /aggregator/categories/10
transhumanismus /aggregator/categories/11
zdroje /aggregator/sources
mapa webu /sitemap
jak správně nastavit tor server /clanky/jak-spr%c3%a1vn%c4%9b-nastavit-tor-server
hesla ve windows 2000/xp /clanky/hesla-ve-windows-2000xp
unix slaví 40 let! ...blahopřejeme a děkujeme :) /clanky/unix-slav%c3%ad-40-let-blahop%c5%99ejeme-d%c4%9bkujeme
ddos na mailserver - klasika v novém kabátě /clanky/ddos-na-mailserver-klasika-v-nov%c3%a9m-kab%c3%a1t%c4%9b
vydána nová verze web server scanneru nikto /clanky/vyd%c3%a1na-nov%c3%a1-verze-web-server-scanneru-nikto
česká pirátská strana /clanky/%c4%8desk%c3%a1-pir%c3%a1tsk%c3%a1-strana
vyvoj dnesni security /blog/vyvoj-dnesni-security
další /popular/all
security /category/tagy/security
hacking /category/tagy/hacking
konference /category/tagy/konference
programming /category/tagy/programming
sp news /category/tagy/sp-news
networks & protocols /category/tagy/networks-protocols
tisková zpráva /category/tagy/tiskov%c3%a1-zpr%c3%a1va
gnu/linux a bsd /category/tagy/gnu/linux-bsd
hacking method /category/tagy/hacking-method
anonymita /category/tagy/anonymita
exploit /category/tagy/exploit
cracking /category/tagy/cracking
více tagů /tagadelic/chunk/2
security-portal.cz - /rss.xml
sp - aktuality - /aggregator/rss/10
sp - usr blogy - /rss-blog.xml
blogy - /aggregator/rss/7
gnu/linux - /aggregator/rss/2
it news - /aggregator/rss/3
hacking - /aggregator/rss/1
exploits - /aggregator/rss/4
infosec institute resources /aggregator/sources/65
hacking & security /aggregator/categories/1
threatpost /aggregator/sources/80
hacking & security /aggregator/categories/1
threatpost /aggregator/sources/80
hacking & security /aggregator/categories/1
sophos naked security /aggregator/sources/72
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
the hacker news /aggregator/sources/73
hacking & security /aggregator/categories/1
sophos naked security /aggregator/sources/72
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
the hacker news /aggregator/sources/73
hacking & security /aggregator/categories/1
zive.cz - bezpečnost /aggregator/sources/76
hacking & security /aggregator/categories/1
threatpost /aggregator/sources/80
hacking & security /aggregator/categories/1
novinky.cz - bezpečnost /aggregator/sources/75
hacking & security /aggregator/categories/1
sophos naked security /aggregator/sources/72
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
sophos naked security /aggregator/sources/72
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
infosec institute resources /aggregator/sources/65
hacking & security /aggregator/categories/1
infosec institute resources /aggregator/sources/65
hacking & security /aggregator/categories/1
threatpost /aggregator/sources/80
hacking & security /aggregator/categories/1
linuxsecurity.com /aggregator/sources/70
hacking & security /aggregator/categories/1
linuxsecurity.com /aggregator/sources/70
hacking & security /aggregator/categories/1
linuxsecurity.com /aggregator/sources/70
hacking & security /aggregator/categories/1
the hacker news /aggregator/sources/73
hacking & security /aggregator/categories/1
ars technica /aggregator/sources/79
hacking & security /aggregator/categories/1
2 /aggregator/categories/1?page=1
3 /aggregator/categories/1?page=2
4 /aggregator/categories/1?page=3
5 /aggregator/categories/1?page=4
6 /aggregator/categories/1?page=5
7 /aggregator/categories/1?page=6
8 /aggregator/categories/1?page=7
9 /aggregator/categories/1?page=8
následující › /aggregator/categories/1?page=1
poslední » /aggregator/categories/1?page=50
- /aggregator/rss/1
přihlásit pomocí openid /%2523
zrušit openid přihlášení /%2523
vytvořit nový účet /user/register
zaslat nové heslo /user/password
:) o tobě psal /blog/definice-%c4%8desk%c3%a9ho-internetu-haters-haters-zase-haters#comment-595
umím zjistit skrytá čísla /clanky/lokalizace-t-mobile-sim-karet#comment-594
youtube /node/3752#comment-593
2 stejné ip adresy /clanky/rozd%c4%9blov%c3%a1n%c3%ad-ip-s%c3%adt%c3%ad#comment-592
mobisec /clanky/registrace-na-security-session-2015-spustena#comment-591
další /comments/recent
další /aggregator/categories/2
další /aggregator/categories/3
další /aggregator/categories/4
home /
články /node
projekty /page/projekty
služby /page/slu%c5%beby-security-portalcz
konference a výstavy /page/konference-v%c3%bdstavy
virové zpravodajství /page/virov%c3%a9-zpravodajstv%c3%ad
hacking filmy /page/hacking-filmy
literatura /page/literatura-e-learning
- rss.xml

Linki zewnętrzne

- https://www.facebook.com/bezpecnost.hacking.komunita
- https://twitter.com/securitycz
securix gnu/linux https://www.securix.org
postřehy z bezpečnosti http://www.root.cz/serialy/postrehy-z-bezpecnosti/#ic=serial-box&icc=title
security session konference https://www.security-session.cz/
můj soused hacker http://sousede.security-portal.cz/
cz & sk tor community http://tor.security-portal.cz/
anon / ip checker http://anoncheck.security-portal.cz/
network tools http://network-tools.security-portal.cz/
convertor http://convertor.security-portal.cz/
sp pastebin http://paste.security-portal.cz
sql injection playground http://flack.security-portal.cz/
web irc http://webirc.security-portal.cz/
cissp history http://resources.infosecinstitute.com/cissp-history/
zeus variant ‘floki bot’ targets pos data http://threatpost.com/zeus-variant-floki-bot-targets-pos-data/122310/
buffer overflow in bsd libc library patched http://threatpost.com/buffer-overflow-in-bsd-libc-library-patched/122305/
news in brief: dirtycow patched for android; naked lack of security; south korea hacked http://feedproxy.google.com/~r/nakedsecurity/~3/_mhud2aopj8/
hacker who stole celebrity emails, sex tapes, movie scripts gets 5 years in prison http://thehackernews.com/2016/12/celebrity-hacker.html
charities hit with fines for sharing donors’ data without consent http://feedproxy.google.com/~r/nakedsecurity/~3/4atjra13ngu/
fórum security-portal.cz - http://forum.security-portal.cz/rss.php?mode=posts
cissp history http://resources.infosecinstitute.com/cissp-history/
zeus variant ‘floki bot’ targets pos data http://threatpost.com/zeus-variant-floki-bot-targets-pos-data/122310/
buffer overflow in bsd libc library patched http://threatpost.com/buffer-overflow-in-bsd-libc-library-patched/122305/
news in brief: dirtycow patched for android; naked lack of security; south korea hacked http://feedproxy.google.com/~r/nakedsecurity/~3/_mhud2aopj8/
hacker who stole celebrity emails, sex tapes, movie scripts gets 5 years in prison http://thehackernews.com/2016/12/celebrity-hacker.html
http://feeds.feedburner.com/~ff/thehackernews_com?a=ec9d6dju4aa:iryrlgfpa9s:yil2auoc8za
http://feeds.feedburner.com/~ff/thehackernews_com?a=ec9d6dju4aa:iryrlgfpa9s:qj6idk7rits
http://feeds.feedburner.com/~ff/thehackernews_com?a=ec9d6dju4aa:iryrlgfpa9s:gin9vfwoqvq
http://feeds.feedburner.com/~ff/thehackernews_com?a=ec9d6dju4aa:iryrlgfpa9s:v_sglipbpwu
http://feeds.feedburner.com/~ff/thehackernews_com?a=ec9d6dju4aa:iryrlgfpa9s:f7zbnmyn0lo
charities hit with fines for sharing donors’ data without consent http://feedproxy.google.com/~r/nakedsecurity/~3/4atjra13ngu/
5-year-old linux kernel local privilege escalation flaw discovered http://thehackernews.com/2016/12/linux-kernel-local-root-exploit.html
http://feeds.feedburner.com/~ff/thehackernews_com?a=bk3b6uprd58:yfp2ojftcvo:yil2auoc8za
http://feeds.feedburner.com/~ff/thehackernews_com?a=bk3b6uprd58:yfp2ojftcvo:qj6idk7rits
http://feeds.feedburner.com/~ff/thehackernews_com?a=bk3b6uprd58:yfp2ojftcvo:gin9vfwoqvq
http://feeds.feedburner.com/~ff/thehackernews_com?a=bk3b6uprd58:yfp2ojftcvo:v_sglipbpwu
http://feeds.feedburner.com/~ff/thehackernews_com?a=bk3b6uprd58:yfp2ojftcvo:f7zbnmyn0lo
v bezpečnostních ip kamerách sony byla nalezena „zadní vrátka“, umožnila administrátorský přístup komukoli http://www.zive.cz/bleskovky/vbezpecnostnich-ip-kamerach-sony-byla-nalezena-zadni-vratka-umoznila-administratorsky-pristup-komukoli/sc-321-a-185212/default.aspx?utm_medium=selfpromo&utm_source=zive&utm_campaign=rssfeed
critical vulnerability patched in roundcube webmail http://threatpost.com/critical-vulnerability-patched-in-roundcube-webmail/122297/
zombie routery chystaly útok v německu a británii, stejný vir dříve odstavil twitter https://www.novinky.cz/internet-a-pc/bezpecnost/422969-zombie-routery-chystaly-utok-v-nemecku-a-britanii-stejny-vir-drive-odstavil-twitter.html
flaw spotted in north korea’s red star operating system http://feedproxy.google.com/~r/nakedsecurity/~3/qfzddya02pm/
nintendo targets 3ds vulnerabilities in new bug bounty http://feedproxy.google.com/~r/nakedsecurity/~3/blz3dwvff0a/
5 benefits of cloud-based end-point security products http://resources.infosecinstitute.com/5-benefits-of-cloud-based-end-point-security-products/
denial of service attack http://resources.infosecinstitute.com/denial-of-service-attack/
hackers gamify ddos attacks with collaborative platform http://threatpost.com/hackers-gamify-ddos-attacks-with-collaborative-platform/122290/
where cybercriminals go to buy your stolen data http://www.linuxsecurity.com/content/view/170071?rdf
blacknurse low-volume dos attack targets firewalls http://www.linuxsecurity.com/content/view/170070?rdf
north korea's linux-based red star os can be hacked remotely with just a link http://www.linuxsecurity.com/content/view/170069?rdf
hacking millions with just an image — recipe: pixels, ads & exploit kit http://thehackernews.com/2016/12/image-exploit-hacking.html
http://feeds.feedburner.com/~ff/thehackernews_com?a=puh-9aq5_v4:9_44a2kct5i:yil2auoc8za
http://feeds.feedburner.com/~ff/thehackernews_com?a=puh-9aq5_v4:9_44a2kct5i:qj6idk7rits
http://feeds.feedburner.com/~ff/thehackernews_com?a=puh-9aq5_v4:9_44a2kct5i:gin9vfwoqvq
http://feeds.feedburner.com/~ff/thehackernews_com?a=puh-9aq5_v4:9_44a2kct5i:v_sglipbpwu
http://feeds.feedburner.com/~ff/thehackernews_com?a=puh-9aq5_v4:9_44a2kct5i:f7zbnmyn0lo
millions exposed to malvertising that hid attack code in banner pixels http://arstechnica.com/security/2016/12/millions-exposed-to-malvertising-that-hid-attack-code-in-banner-pixels/
steganography https://en.wikipedia.org/wiki/steganography
https://cdn.arstechnica.net/wp-content/uploads/2016/12/stegano-comparison.png
left: clean picture; middle: picture with malicious content; right: malicious version enhanced for illustrative purposes. https://cdn.arstechnica.net/wp-content/uploads/2016/12/stegano-comparison.png
alpha channel https://en.wikipedia.org/wiki/rgba_color_space
read 6 remaining paragraphs http://arstechnica.com/security/2016/12/millions-exposed-to-malvertising-that-hid-attack-code-in-banner-pixels/#p3
comments http://arstechnica.com/security/2016/12/millions-exposed-to-malvertising-that-hid-attack-code-in-banner-pixels/?comments=1
co je openid? http://openid.net/
- http://www.stech.cz/konference/ict.aspx
- http://cryptofest.cz/?node=program
- http://www.security-session.cz
-
-
-
-
-
-
http://www.itsw.cz
- http://idc-czech.cz/cze/konference/56985-idc-cloud-computing-conference-2014/7-overview
- http://www.bezpecnostvcloudu.cz
- http://idc-cema.com/eng/events/56335-idc-it-security-roadshow-2014?g_clang=cze
- http://www.europen.cz
- http://www.planujakci.cz/
- http://brmlab.cz
http://www.ceskapiratskastrana.cz
- http://bflow.security-portal.cz/
- http://secit.sk/
http://www.blackhole.sk
- http://www.skodlivysoftware.cz/
http://www.viry.cz
- http://hack4fun.eu/
síťový stack v linuxu: nejen pro router a nat https://www.root.cz/clanky/sitovy-stack-v-linuxu-nejen-pro-router-a-nat/?utm_source=rss&utm_medium=text&utm_campaign=rss
programovací jazyk rust: metody a traity https://www.root.cz/clanky/programovaci-jazyk-rust-metody-a-traity/?utm_source=rss&utm_medium=text&utm_campaign=rss
xen project hypervisor 4.8 http://www.abclinuxu.cz/zpravicky/xen-project-hypervisor-4.8
retroengine sigma, herní mini konzole a multimediální centrum http://www.abclinuxu.cz/zpravicky/retroengine-sigma-herni-mini-konzole-a-multimedialni-centrum
wordpress 4.7 "vaughan" http://www.abclinuxu.cz/zpravicky/wordpress-4.7-vaughan
finanční poradce: nepřijel jsem prodávat, to vy chcete koupit http://www.mesec.cz/clanky/financni-poradce-neprijel-jsem-prodavat-to-vy-chcete-koupit/?utm_source=rss&utm_medium=text&utm_campaign=rss
o nevyčerpanou dovolenou nepřijdete. proplatit ji ale firma nemůže http://www.mesec.cz/clanky/o-nevycerpanou-dovolenou-neprijdete-proplatit-firma-nemuze/?utm_source=rss&utm_medium=text&utm_campaign=rss
western digital představil 12tb a 14tb hdd http://diit.cz/clanek/western-digital-predstavil-12tb-14tb-hdd#utm_source=atom&utm_medium=feed&utm_content=article
nejlepší notebooky nad 20 tisíc: poradíme, které teď chcete http://www.zive.cz/clanky/nejlepsi-notebooky-nad-20-tisic-poradime-ktere-ted-chcete/sc-3-a-185216/default.aspx
facebook vám vyrobil video shrnující váš rok 2016. podívejte se http://www.zive.cz/bleskovky/facebook-vam-vyrobil-video-shrnujici-vas-rok-2016-podivejte-se/sc-4-a-185217/default.aspx
linux kernel 4.4.0 ubuntu 14.04/16.04 x86-64 af_packet race condition privilege escalation http://www.intelligentexploit.com/view-details.html?id=25463
pwc ace software for sap security 8.10.304 abap injection http://www.intelligentexploit.com/view-details.html?id=25464
firefox svg cross domain cookie vulnerability http://www.intelligentexploit.com/view-details.html?id=25462
microsoft windows 10 x86/x64 wlan autoconfig named pipe proof of concept http://www.intelligentexploit.com/view-details.html?id=25455
edge skateshop authentication bypass http://www.intelligentexploit.com/view-details.html?id=25456
- http://creativecommons.org/licenses/by-sa/3.0/
creative commons attribution-share alike 3.0 unported license http://creativecommons.org/licenses/by-sa/3.0/
- http://drupal.org
dr. radut http://www.radut.net/

Zdjęcia

Zdjęcia 40
Zdjęcia bez atrybutu ALT 11
Zdjęcia bez atrybutu TITLE 36
Korzystanie Obraz ALT i TITLE atrybutu dla każdego obrazu.

Zdjęcia bez atrybutu TITLE

/sites/default/files/images/facebook-button.gif
/sites/default/files/images/twitter-sp.gif
/sites/default/files/salamander12-white_logo.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
http://www.security-portal.cz/sites/default/files/securitysessionbanner.gif
http://www.expo-net.cz/foto/loga_nase/o-logo_itsw.jpg
/sites/default/files/idc-cc-120x60-cz.gif
http://www.bezpecnostvcloudu.cz/files/clanky/ikonka_bvc.gif
/sites/default/files/idc.gif
http://www.security-portal.cz/sites/default/files/europen.png
http://www.security-portal.cz/img/logo/planujakci/planujakci-cz-4.gif
http://www.security-portal.cz/img/logo/brmlab/brmlab.gif
http://www.ceskapiratskastrana.cz/media/grafika/cps_banner_88x31_whitebg.gif
http://bflow.security-portal.cz/banner/banner2.gif
http://www.security-portal.cz/img/logo/secit/secit.png
http://www.security-portal.cz/img/logo/blackhole/blackhole1.gif
http://www.skodlivysoftware.cz/images/banner.gif
http://www.security-portal.cz/img/logo/viry/viry_cz.gif
http://www.security-portal.cz/img/logo/hack4fun/hack4fun-banner1.jpg
http://i.creativecommons.org/l/by-sa/3.0/80x15.png
/misc/feed.png

Zdjęcia bez atrybutu ALT

/sites/default/files/images/facebook-button.gif
/sites/default/files/images/twitter-sp.gif
http://www.stech.cz/portals/0/konference/2015/06%20ict/90x60.gif
/sites/default/files/images/cryptofest.png
http://www.security-portal.cz/sites/default/files/securitysessionbanner.gif
http://www.expo-net.cz/foto/loga_nase/o-logo_itsw.jpg
http://www.bezpecnostvcloudu.cz/files/clanky/ikonka_bvc.gif
/sites/default/files/idc.gif
http://www.security-portal.cz/sites/default/files/europen.png
http://www.security-portal.cz/img/logo/planujakci/planujakci-cz-4.gif
http://bflow.security-portal.cz/banner/banner2.gif

Ranking:


Alexa Traffic
Daily Global Rank Trend
Daily Reach (Percent)









Majestic SEO











Text on page:

hledat na tomto webu: když jsou svíce zhasnuty, všechny ženy jsou krásné. — plutarchos menu home články projektysecurix gnu/linux postřehy z bezpečnosti security session konference hackerspace v čr můj soused hacker cz & sk tor community službyanon / ip checker network tools convertor security-portal.cz trička sp pastebin password generator sql injection playground web irc wallpapery konference a výstavy virové zpravodajství hacking filmy literatura filozofie serveru přidejte se k nám! podpořte nás! rady pro psaní autoři serveru mapa webu kontakt & irc dnešní oblíbený obsah analýza cíleného útoku, část první (30) kybernetický zákon – téma pro it security workshop (17) kontaktní informace (12) google hacking... (profesionalne) (12) rozdělování ip sítí (12) filozofie serveru security-portal.cz (9) další aktuality cissp history zeus variant ‘floki bot’ targets pos data buffer overflow in bsd libc library patched news in brief: dirtycow patched for android; naked lack of security; south korea hacked hacker who stole celebrity emails, sex tapes, movie scripts gets 5 years in prison charities hit with fines for sharing donors’ data without consent další nejnovější příspěvky blogu upřímní rapeři byli zatčeni za carding anonymous odcizili osobní údaje 5400 španělských policistů cena uniklých dat: linkedin, thumblr, myspace uk: ztracené peníze z vašeho bankovního účtu? no, je to vaše vina cryptxxx znovu aktualizován, doposud žádné dešifrování ani po zaplacení výkupného další select languageczechafrikaansalbanianarabicbelarusianbulgariancatalanchinese (simplified)chinese (traditional)croatiandanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish navigace blogy obrázky poslední příspěvky oblíbený obsah agregátor rsskategorieaktuality transhumanismus zdroje mapa webu náhodný obsah jak správně nastavit tor server (18,563) hesla ve windows 2000/xp (73,293) unix slaví 40 let! ...blahopřejeme a děkujeme :) (9,219) ddos na mailserver - klasika v novém kabátě (17,736) vydána nová verze web server scanneru nikto (10,130) česká pirátská strana (18,733) vyvoj dnesni security (23,164) další tagy security hacking konference programming sp news networks & protocols tisková zpráva gnu/linux a bsd hacking method anonymita exploit cracking více tagů rss feed security-portal.cz sp - aktuality sp - usr blogy fórum security-portal.cz rss feed aggregator: blogy gnu/linux it news hacking exploits security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech. kategorie cissp history infosec institute resources - 7 prosinec, 2016 - 22:54 during the late 1980s, the need for vendor-independent certification programs in the field of information security was high. as a result, the international information security certification consortium or (isc) ² came into existence in 1989. a non-profit organization, it has since then become famous for providing standardized information security certifications. the certified information systems security […] kategorie: hacking & security zeus variant ‘floki bot’ targets pos data threatpost - 7 prosinec, 2016 - 21:26 researchers have observed an uptick in attacks using the banking malware floki bot against u.s., canadian and brazilian banks and insurance firms. kategorie: hacking & security buffer overflow in bsd libc library patched threatpost - 7 prosinec, 2016 - 20:55 the bsd libc library was updated recently to address a buffer overflow vulnerability that could have allowed an attacker to execute arbitrary code. kategorie: hacking & security news in brief: dirtycow patched for android; naked lack of security; south korea hacked sophos naked security - 7 prosinec, 2016 - 19:34 your daily round-up of what else is in the news kategorie: hacking & security, viry a červi hacker who stole celebrity emails, sex tapes, movie scripts gets 5 years in prison the hacker news - 7 prosinec, 2016 - 17:20 a hacker who was arrested last year for hacking into celebrities' email accounts to steal the unreleased movie and television scripts, their private messages, and sex tapes to sell them has finally been sentenced five years in prison. alonzo knowles, a 24-year-old bahamian man, was convicted by u.s. district judge paul a. engelmayer in manhattan on tuesday. knowles, who maintained a list of kategorie: hacking & security charities hit with fines for sharing donors’ data without consent sophos naked security - 7 prosinec, 2016 - 17:17 animal and heart charities built up pictures of donors without their knowledge to target them for cash kategorie: hacking & security, viry a červi 5-year-old linux kernel local privilege escalation flaw discovered the hacker news - 7 prosinec, 2016 - 17:14 a 5-year-old serious privilege-escalation vulnerability has been discovered in linux kernel that affects almost every distro of the linux operating system, including redhat, and ubuntu. over a month back, a nine-year-old privilege-escalation vulnerability, dubbed "dirty cow," was discovered in the linux kernel that affected every distro of the open-source operating system, including red hat, kategorie: hacking & security v bezpečnostních ip kamerách sony byla nalezena „zadní vrátka“, umožnila administrátorský přístup komukoli zive.cz - bezpečnost - 7 prosinec, 2016 - 16:25 s rozmachem internetu věcí vzniká i rozmach bezpečnostních hrozeb z počtu zařízení, která lze hacknout kvůli chybám v jejich zabezpečení. ironií je, že tentokrát se ale problém objevil u profesionálních bezpečnostních kamer od sony řady ipela engine . jak objevila bezpečnostní společnost sec ... kategorie: hacking & security critical vulnerability patched in roundcube webmail threatpost - 7 prosinec, 2016 - 16:00 open source webmail provider roundcube was patched against a vulnerability that could be trivially exploited to run code on servers or access email accounts. kategorie: hacking & security zombie routery chystaly útok v německu a británii, stejný vir dříve odstavil twitter novinky.cz - bezpečnost - 7 prosinec, 2016 - 15:59 říjnový masový výpadek sociální sítě twitter, ale také internetového obchodu amazon nebo facebooku ve spojených státech, k němuž došlo při masovém ddos útoku přes zařízení napojená na sítě internetu věcí, se tento týden v menším měřítku zopakoval v německu a ve velké británii. kategorie: hacking & security flaw spotted in north korea’s red star operating system sophos naked security - 7 prosinec, 2016 - 15:29 flaw in bundled browser could give an attacker complete control over a user's pc kategorie: hacking & security, viry a červi nintendo targets 3ds vulnerabilities in new bug bounty sophos naked security - 7 prosinec, 2016 - 14:37 bug bounty program focuses on hardware exploits kategorie: hacking & security, viry a červi 5 benefits of cloud-based end-point security products infosec institute resources - 7 prosinec, 2016 - 14:00 with the emergence of cloud technologies, many products arrived that utilized the newly created possibilities in one way or another. of course, some very good security products have been created that benefit from these possibilities as well. end-point security products, which are basically the old anti-virus suites, have probably been transformed the most in this […] kategorie: hacking & security denial of service attack infosec institute resources - 7 prosinec, 2016 - 14:00 in this post, we examine the dos (denial of service attack), how it works, what’s the impact of such an attack, and some tools to perform this kind of exploitation in different vectors. the dos attack is one of the most destructive attacks on the web. it attempts to exhaust the resources of the victim […] kategorie: hacking & security hackers gamify ddos attacks with collaborative platform threatpost - 7 prosinec, 2016 - 14:00 a hacking group is luring participants to use a ddos platform where they can compete with peers to earn redeemable points exchangeable for hacking tools and click-fraud software. kategorie: hacking & security where cybercriminals go to buy your stolen data linuxsecurity.com - 7 prosinec, 2016 - 11:04 linuxsecurity.com: with nothing more than a standard web browser, cybercriminals can find personal, private information all over the public internet. it isn't just legitimate services - from genealogy sites to public records and social media - that can be mined and exploited for nefarious purposes. openly malicious criminal activities are also happening on the public internet. kategorie: hacking & security blacknurse low-volume dos attack targets firewalls linuxsecurity.com - 7 prosinec, 2016 - 10:57 linuxsecurity.com: a type of denial of service attack relevant in the 1990s has resurfaced with surprising potency against modern-day firewalls. dubbed a blacknurse attack, the technique leverages a low-volume internet control message protocol (icmp) -based attack on vulnerable firewalls made by cisco, palo alto, sonicwall and others, according to researchers. kategorie: hacking & security north korea's linux-based red star os can be hacked remotely with just a link linuxsecurity.com - 7 prosinec, 2016 - 10:56 linuxsecurity.com: north korea's own homegrown computer operating system, that's supposed to be fully hacker proof and more secure than foreign os, like microsoft's windows, can easily be hacked remotely. kategorie: hacking & security hacking millions with just an image — recipe: pixels, ads & exploit kit the hacker news - 7 prosinec, 2016 - 09:09 if you have visited any popular mainstream website over the past two months, your computer may have been infected — thanks to a new exploit kit discovered by security researchers. researchers from antivirus provider eset released a report on tuesday stating that they have discovered an exploit kit, dubbed stegano, hiding malicious code in the pixels of banner advertisements that are currently kategorie: hacking & security millions exposed to malvertising that hid attack code in banner pixels ars technica - 6 prosinec, 2016 - 23:16 millions of people visiting mainstream websites over the past two months have been exposed to a novel form of malicious ads that embed attack code in individual pixels of the banners. researchers from antivirus provider eset said "stegano," as they've dubbed the campaign, dates back to 2014. beginning in early october, its unusually stealthy operators scored a major coup by getting the ads displayed on a variety of unnamed reputable news sites, each with millions of daily visitors. borrowing from the word steganography—the practice of concealing secret messages inside a larger document that dates back to at least 440 bc—stegano hides parts of its malicious code in parameters controlling the transparency of pixels used to display banner ads. while the attack code alters the tone or color of the images, the changes are almost invisible to the untrained eye. left: clean picture; middle: picture with malicious content; right: malicious version enhanced for illustrative purposes. (credit: eset) the malicious script is concealed in the alpha channel that defines the transparency of pixels, making it extremely difficult for even sharp-eyed ad networks to detect. after verifying that the targeted browser isn't running in a virtual machine or connected to other types of security software often used to detect attacks, the script redirects the browser to a site that hosts three exploits for now-patched adobe flash vulnerabilities. read 6 remaining paragraphs | comments kategorie: hacking & security 1 2 3 4 5 6 7 8 9 … následující › poslední » přihlášení přihlásit pomocí openid: co je openid? uživatelské jméno: * heslo: * přihlásit pomocí openid zrušit openid přihlášení vytvořit nový účet zaslat nové heslo poslední komentáře :) o tobě psal před 5 týdnů 4 dny umím zjistit skrytá čísla před 14 týdnů 1 den youtube před 28 týdnů 1 den 2 stejné ip adresy před 32 týdny 1 den mobisec před 1 týden 2 dny další konference doporučujeme gnu/linux & bsd síťový stack v linuxu: nejen pro router a nat programovací jazyk rust: metody a traity xen project hypervisor 4.8 retroengine sigma, herní mini konzole a multimediální centrum wordpress 4.7 "vaughan" další it news finanční poradce: nepřijel jsem prodávat, to vy chcete koupit o nevyčerpanou dovolenou nepřijdete. proplatit ji ale firma nemůže western digital představil 12tb a 14tb hdd nejlepší notebooky nad 20 tisíc: poradíme, které teď chcete facebook vám vyrobil video shrnující váš rok 2016. podívejte se další security vulnerabilities & exploits linux kernel 4.4.0 ubuntu 14.04/16.04 x86-64 af_packet race condition privilege escalation pwc ace software for sap security 8.10.304 abap injection firefox svg cross domain cookie vulnerability microsoft windows 10 x86/x64 wlan autoconfig named pipe proof of concept edge skateshop authentication bypass další home články projekty služby konference a výstavy virové zpravodajství hacking filmy literatura this work is licensed under a creative commons attribution-share alike 3.0 unported license. cc-by-sa security-portal.cz | secured by paranoid sense | we hack to learn by dr. radut


Here you find all texts from your page as Google (googlebot) and others search engines seen it.

Words density analysis:

Numbers of all words: 1979

One word

Two words phrases

Three words phrases

the - 3.18% (63)
sec - 3.13% (62)
security - 2.68% (53)
pro - 2.63% (52)
hack - 2.37% (47)
hacking - 1.57% (31)
for - 1.31% (26)
kategorie - 1.11% (22)
2016 - 1.06% (21)
prosinec, - 1.01% (20)
kategorie: - 1.01% (20)
pos - 0.96% (19)
linux - 0.91% (18)
and - 0.91% (18)
attack - 0.86% (17)
that - 0.81% (16)
red - 0.71% (14)
with - 0.71% (14)
new - 0.66% (13)
over - 0.66% (13)
tor - 0.61% (12)
are - 0.61% (12)
ace - 0.61% (12)
exploit - 0.61% (12)
form - 0.56% (11)
ani - 0.56% (11)
vir - 0.56% (11)
all - 0.56% (11)
web - 0.56% (11)
hacker - 0.51% (10)
news - 0.51% (10)
den - 0.45% (9)
další - 0.4% (8)
při - 0.4% (8)
year - 0.4% (8)
have - 0.4% (8)
bezpečnost - 0.4% (8)
server - 0.35% (7)
internet - 0.35% (7)
code - 0.35% (7)
patched - 0.35% (7)
dos - 0.35% (7)
malicious - 0.35% (7)
open - 0.35% (7)
can - 0.35% (7)
its - 0.35% (7)
source - 0.3% (6)
korea - 0.3% (6)
was - 0.3% (6)
target - 0.3% (6)
security-portal.cz - 0.3% (6)
site - 0.3% (6)
been - 0.3% (6)
gets - 0.3% (6)
work - 0.3% (6)
vulnerability - 0.3% (6)
pixels - 0.3% (6)
bsd - 0.3% (6)
use - 0.3% (6)
linuxsecurity.com - 0.3% (6)
před - 0.3% (6)
naked - 0.3% (6)
discovered - 0.25% (5)
— - 0.25% (5)
two - 0.25% (5)
script - 0.25% (5)
program - 0.25% (5)
has - 0.25% (5)
data - 0.25% (5)
konference - 0.25% (5)
researchers - 0.25% (5)
information - 0.25% (5)
ale - 0.25% (5)
from - 0.25% (5)
you - 0.25% (5)
old - 0.25% (5)
system - 0.25% (5)
že - 0.2% (4)
hacked - 0.2% (4)
threatpost - 0.2% (4)
dubbed - 0.2% (4)
targets - 0.2% (4)
attacks - 0.2% (4)
sophos - 0.2% (4)
operating - 0.2% (4)
security, - 0.2% (4)
viry - 0.2% (4)
červi - 0.2% (4)
email - 0.2% (4)
ars - 0.2% (4)
escalation - 0.2% (4)
privilege - 0.2% (4)
kernel - 0.2% (4)
banner - 0.2% (4)
bezpečnostní - 0.2% (4)
openid - 0.2% (4)
resources - 0.2% (4)
ads - 0.2% (4)
service - 0.2% (4)
one - 0.2% (4)
… - 0.2% (4)
gnu/linux - 0.2% (4)
products - 0.2% (4)
ddos - 0.2% (4)
lack - 0.2% (4)
this - 0.2% (4)
millions - 0.2% (4)
most - 0.2% (4)
who - 0.2% (4)
exploits - 0.2% (4)
browser - 0.2% (4)
eset - 0.15% (3)
14:00 - 0.15% (3)
just - 0.15% (3)
message - 0.15% (3)
linuxsecurity.com: - 0.15% (3)
flaw - 0.15% (3)
very - 0.15% (3)
firewalls - 0.15% (3)
than - 0.15% (3)
-based - 0.15% (3)
... - 0.15% (3)
denial - 0.15% (3)
sítě - 0.15% (3)
kit - 0.15% (3)
criminal - 0.15% (3)
provider - 0.15% (3)
útok - 0.15% (3)
bezpečnostních - 0.15% (3)
home - 0.15% (3)
they - 0.15% (3)
system, - 0.15% (3)
past - 0.15% (3)
north - 0.15% (3)
control - 0.15% (3)
vulnerabilities - 0.15% (3)
network - 0.15% (3)
sites - 0.15% (3)
tools - 0.15% (3)
month - 0.15% (3)
obsah - 0.15% (3)
donors - 0.15% (3)
poslední - 0.15% (3)
webu - 0.15% (3)
infosec - 0.15% (3)
used - 0.15% (3)
rss - 0.15% (3)
stole - 0.15% (3)
serveru - 0.15% (3)
picture - 0.15% (3)
windows - 0.15% (3)
sex - 0.15% (3)
blogy - 0.15% (3)
libc - 0.15% (3)
movie - 0.15% (3)
scripts - 0.15% (3)
years - 0.15% (3)
prison - 0.15% (3)
other - 0.15% (3)
no, - 0.15% (3)
software - 0.15% (3)
without - 0.15% (3)
charities - 0.15% (3)
hit - 0.15% (3)
library - 0.15% (3)
institute - 0.15% (3)
certification - 0.15% (3)
bot - 0.15% (3)
tapes - 0.15% (3)
hid - 0.15% (3)
(12) - 0.15% (3)
aktuality - 0.15% (3)
back - 0.15% (3)
your - 0.15% (3)
could - 0.15% (3)
dny - 0.15% (3)
overflow - 0.15% (3)
against - 0.15% (3)
public - 0.15% (3)
floki - 0.15% (3)
word - 0.15% (3)
buffer - 0.15% (3)
fines - 0.15% (3)
týdnů - 0.15% (3)
[…] - 0.15% (3)
přihlásit - 0.1% (2)
nat - 0.1% (2)
isn't - 0.1% (2)
blacknurse - 0.1% (2)
low-volume - 0.1% (2)
protocol - 0.1% (2)
mini - 0.1% (2)
nad - 0.1% (2)
nový - 0.1% (2)
router - 0.1% (2)
pomocí - 0.1% (2)
heslo - 0.1% (2)
přihlášení - 0.1% (2)
chcete - 0.1% (2)
nové - 0.1% (2)
purposes. - 0.1% (2)
type - 0.1% (2)
proof - 0.1% (2)
researchers. - 0.1% (2)
microsoft - 0.1% (2)
exposed - 0.1% (2)
dates - 0.1% (2)
tuesday - 0.1% (2)
released - 0.1% (2)
antivirus - 0.1% (2)
may - 0.1% (2)
služby - 0.1% (2)
projekty - 0.1% (2)
website - 0.1% (2)
mainstream - 0.1% (2)
messages - 0.1% (2)
edge - 0.1% (2)
any - 0.1% (2)
named - 0.1% (2)
race - 0.1% (2)
korea's - 0.1% (2)
transparency - 0.1% (2)
pixels, - 0.1% (2)
ubuntu - 0.1% (2)
image - 0.1% (2)
display - 0.1% (2)
like - 0.1% (2)
secure - 0.1% (2)
stegano, - 0.1% (2)
computer - 0.1% (2)
own - 0.1% (2)
link - 0.1% (2)
facebook - 0.1% (2)
remotely - 0.1% (2)
detect - 0.1% (2)
months - 0.1% (2)
jsou - 0.1% (2)
internet. - 0.1% (2)
jak - 0.1% (2)
celebrity - 0.1% (2)
emails, - 0.1% (2)
tapes, - 0.1% (2)
sharing - 0.1% (2)
donors’ - 0.1% (2)
consent - 0.1% (2)
příspěvky - 0.1% (2)
vaše - 0.1% (2)
networks - 0.1% (2)
security; - 0.1% (2)
více - 0.1% (2)
feed - 0.1% (2)
zajímavých - 0.1% (2)
into - 0.1% (2)
then - 0.1% (2)
attacker - 0.1% (2)
daily - 0.1% (2)
what - 0.1% (2)
south - 0.1% (2)
android; - 0.1% (2)
steal - 0.1% (2)
filozofie - 0.1% (2)
články - 0.1% (2)
injection - 0.1% (2)
irc - 0.1% (2)
výstavy - 0.1% (2)
virové - 0.1% (2)
zpravodajství - 0.1% (2)
filmy - 0.1% (2)
literatura - 0.1% (2)
mapa - 0.1% (2)
dirtycow - 0.1% (2)
kontakt - 0.1% (2)
oblíbený - 0.1% (2)
cissp - 0.1% (2)
history - 0.1% (2)
zeus - 0.1% (2)
variant - 0.1% (2)
‘floki - 0.1% (2)
bot’ - 0.1% (2)
brief: - 0.1% (2)
accounts - 0.1% (2)
their - 0.1% (2)
standard - 0.1% (2)
created - 0.1% (2)
zařízení - 0.1% (2)
tento - 0.1% (2)
týden - 0.1% (2)
star - 0.1% (2)
bug - 0.1% (2)
bounty - 0.1% (2)
end-point - 0.1% (2)
cloud - 0.1% (2)
possibilities - 0.1% (2)
twitter - 0.1% (2)
some - 0.1% (2)
benefit - 0.1% (2)
attack, - 0.1% (2)
hackers - 0.1% (2)
platform - 0.1% (2)
where - 0.1% (2)
earn - 0.1% (2)
cybercriminals - 0.1% (2)
more - 0.1% (2)
útoku - 0.1% (2)
německu - 0.1% (2)
private - 0.1% (2)
including - 0.1% (2)
them - 0.1% (2)
knowles, - 0.1% (2)
u.s. - 0.1% (2)
5-year-old - 0.1% (2)
privilege-escalation - 0.1% (2)
almost - 0.1% (2)
every - 0.1% (2)
distro - 0.1% (2)
hat, - 0.1% (2)
run - 0.1% (2)
sony - 0.1% (2)
internetu - 0.1% (2)
rozmach - 0.1% (2)
objevil - 0.1% (2)
kamer - 0.1% (2)
engine - 0.1% (2)
roundcube - 0.1% (2)
webmail - 0.1% (2)
exploited - 0.1% (2)
věcí - 0.1% (2)
2016 - - 1.01% (20)
prosinec, 2016 - 1.01% (20)
hacking & - 1.01% (20)
kategorie: hacking - 1.01% (20)
& security - 1.01% (20)
7 prosinec, - 0.96% (19)
in the - 0.3% (6)
of the - 0.3% (6)
security, viry - 0.2% (4)
operating system - 0.2% (4)
threatpost - - 0.2% (4)
linux kernel - 0.2% (4)
code in - 0.2% (4)
security - - 0.2% (4)
sophos naked - 0.2% (4)
a červi - 0.2% (4)
viry a - 0.2% (4)
& security, - 0.2% (4)
floki bot - 0.15% (3)
information security - 0.15% (3)
[…] kategorie: - 0.15% (3)
security products - 0.15% (3)
linuxsecurity.com - - 0.15% (3)
dos attack - 0.15% (3)
resources - - 0.15% (3)
- 14:00 - 0.15% (3)
institute resources - 0.15% (3)
sex tapes - 0.15% (3)
have been - 0.15% (3)
of service - 0.15% (3)
news - - 0.15% (3)
the hacker - 0.15% (3)
hacker news - 0.15% (3)
years in - 0.15% (3)
infosec institute - 0.15% (3)
in prison - 0.15% (3)
denial of - 0.15% (3)
attack code - 0.15% (3)
hacker who - 0.15% (3)
exploit kit - 0.15% (3)
bsd libc - 0.15% (3)
over the - 0.15% (3)
service attack - 0.15% (3)
end-point security - 0.1% (2)
to detect - 0.1% (2)
přihlásit pomocí - 0.1% (2)
před 1 - 0.1% (2)
that the - 0.1% (2)
of cloud - 0.1% (2)
transparency of - 0.1% (2)
malicious code - 0.1% (2)
privilege escalation - 0.1% (2)
back to - 0.1% (2)
červi 5 - 0.1% (2)
the most - 0.1% (2)
from the - 0.1% (2)
in this - 0.1% (2)
two months - 0.1% (2)
dates back - 0.1% (2)
pixels of - 0.1% (2)
exposed to - 0.1% (2)
the past - 0.1% (2)
on tuesday - 0.1% (2)
antivirus provider - 0.1% (2)
researchers from - 0.1% (2)
past two - 0.1% (2)
mainstream website - 0.1% (2)
the public - 0.1% (2)
can be - 0.1% (2)
& exploit - 0.1% (2)
with just - 0.1% (2)
hacked remotely - 0.1% (2)
north korea's - 0.1% (2)
bug bounty - 0.1% (2)
a výstavy - 0.1% (2)
red star - 0.1% (2)
news in - 0.1% (2)
tapes, movie - 0.1% (2)
emails, sex - 0.1% (2)
stole celebrity - 0.1% (2)
korea hacked - 0.1% (2)
security; south - 0.1% (2)
lack of - 0.1% (2)
android; naked - 0.1% (2)
patched for - 0.1% (2)
brief: dirtycow - 0.1% (2)
library patched - 0.1% (2)
5 years - 0.1% (2)
overflow in - 0.1% (2)
targets pos - 0.1% (2)
‘floki bot’ - 0.1% (2)
zeus variant - 0.1% (2)
cissp history - 0.1% (2)
filozofie serveru - 0.1% (2)
oblíbený obsah - 0.1% (2)
mapa webu - 0.1% (2)
hacking filmy - 0.1% (2)
scripts gets - 0.1% (2)
charities hit - 0.1% (2)
německu a - 0.1% (2)
an attacker - 0.1% (2)
- bezpečnost - 0.1% (2)
v německu - 0.1% (2)
bezpečnost - - 0.1% (2)
system, including - 0.1% (2)
every distro - 0.1% (2)
kernel that - 0.1% (2)
virové zpravodajství - 0.1% (2)
email accounts - 0.1% (2)
for hacking - 0.1% (2)
that could - 0.1% (2)
with fines - 0.1% (2)
a buffer - 0.1% (2)
pos data - 0.1% (2)
bot’ targets - 0.1% (2)
variant ‘floki - 0.1% (2)
it news - 0.1% (2)
security hacking - 0.1% (2)
without consent - 0.1% (2)
donors’ data - 0.1% (2)
for sharing - 0.1% (2)
články projekty - 0.1% (2)
kategorie: hacking & - 1.01% (20)
hacking & security - 1.01% (20)
prosinec, 2016 - - 1.01% (20)
7 prosinec, 2016 - 0.96% (19)
- 7 prosinec, - 0.96% (19)
security, viry a - 0.2% (4)
viry a červi - 0.2% (4)
hacking & security, - 0.2% (4)
security - 7 - 0.2% (4)
sophos naked security - 0.2% (4)
threatpost - 7 - 0.2% (4)
naked security - - 0.2% (4)
hacker news - - 0.15% (3)
the hacker news - 0.15% (3)
bsd libc library - 0.15% (3)
[…] kategorie: hacking - 0.15% (3)
of service attack - 0.15% (3)
institute resources - - 0.15% (3)
2016 - 14:00 - 0.15% (3)
linuxsecurity.com - 7 - 0.15% (3)
denial of service - 0.15% (3)
infosec institute resources - 0.15% (3)
researchers from antivirus - 0.1% (2)
donors’ data without - 0.1% (2)
a výstavy virové - 0.1% (2)
from antivirus provider - 0.1% (2)
past two months - 0.1% (2)
attack code in - 0.1% (2)
malicious code in - 0.1% (2)
distro of the - 0.1% (2)
the past two - 0.1% (2)
linux kernel that - 0.1% (2)
bezpečnost - 7 - 0.1% (2)
with just a - 0.1% (2)
be hacked remotely - 0.1% (2)
the public internet. - 0.1% (2)
fines for sharing - 0.1% (2)
výstavy virové zpravodajství - 0.1% (2)
hacker who stole - 0.1% (2)
charities hit with - 0.1% (2)
with fines for - 0.1% (2)
‘floki bot’ targets - 0.1% (2)
overflow in bsd - 0.1% (2)
libc library patched - 0.1% (2)
news in brief: - 0.1% (2)
dirtycow patched for - 0.1% (2)
android; naked lack - 0.1% (2)
of security; south - 0.1% (2)
who stole celebrity - 0.1% (2)
emails, sex tapes, - 0.1% (2)
movie scripts gets - 0.1% (2)
5 years in - 0.1% (2)
sharing donors’ data - 0.1% (2)
gets 5 years - 0.1% (2)
linux a bsd - 0.1% (2)
variant ‘floki bot’ - 0.1% (2)
targets pos data - 0.1% (2)
buffer overflow in - 0.1% (2)
in brief: dirtycow - 0.1% (2)
patched for android; - 0.1% (2)
naked lack of - 0.1% (2)
security; south korea - 0.1% (2)
hacking filmy literatura - 0.1% (2)
celebrity emails, sex - 0.1% (2)
tapes, movie scripts - 0.1% (2)
zpravodajství hacking filmy - 0.1% (2)

Here you can find chart of all your popular one, two and three word phrases. Google and others search engines means your page is about words you use frequently.

Copyright © 2015-2016 hupso.pl. All rights reserved. FB | +G | Twitter

Hupso.pl jest serwisem internetowym, w którym jednym kliknieciem możesz szybko i łatwo sprawdź stronę www pod kątem SEO. Oferujemy darmowe pozycjonowanie stron internetowych oraz wycena domen i stron internetowych. Prowadzimy ranking polskich stron internetowych oraz ranking stron alexa.