3.01 score from hupso.pl for:
security-portal.cz



HTML Content


Titlesecurity-portal.cz | bezpečnost • hacking • komunita

Length: 52, Words: 6
Description pusty

Length: 0, Words: 0
Keywords pusty
Robots
Charset UTF-8
Og Meta - Title pusty
Og Meta - Description pusty
Og Meta - Site name pusty
Tytuł powinien zawierać pomiędzy 10 a 70 znaków (ze spacjami), a mniej niż 12 słów w długości.
Meta opis powinien zawierać pomiędzy 50 a 160 znaków (łącznie ze spacjami), a mniej niż 24 słów w długości.
Kodowanie znaków powinny być określone , UTF-8 jest chyba najlepszy zestaw znaków, aby przejść z powodu UTF-8 jest bardziej międzynarodowy kodowaniem.
Otwarte obiekty wykresu powinny być obecne w stronie internetowej (więcej informacji na temat protokołu OpenGraph: http://ogp.me/)

SEO Content

Words/Characters 3490
Text/HTML 30.12 %
Headings H1 1
H2 20
H3 20
H4 0
H5 0
H6 0
H1
kategorie
H2


menu
dnešní oblíbený obsah
aktuality
nejnovější příspěvky blogu

navigace
náhodný obsah
tagy
rss feed
přihlášení
poslední komentáře
konference
doporučujeme
gnu/linux & bsd
it news
security vulnerabilities & exploits

H3
virulent android malware returns, gets >2 million downloads on google play
apple patches critical kernel vulnerabilities
secure email service lavabit relaunches
heartbleed persists on 200,000 servers, devices
this bug could allow hackers to delete any video on facebook
auto vás může šmírovat! fbi využívá bezpečnostní systémy aut pro sledování i odposlech
sage and satan ransomware, double trouble
massive twitter botnet dormant since 2013
st jude case highlights ongoing divide over ‘responsible bugs disclosure’
hooking and patching android apps using xposed framework
insidious gmail phishing attacks: new variants leveraging an old scheme
israeli soldiers duped into installing malware via fake facebook profiles
francie se připravuje na kyberútoky během květnových prezidentských voleb
over 199,500 websites are still vulnerable to heartbleed openssl bug
monday review – the hot 31 stories of the week
expensive free apps
source code for another android banking malware leaked
russian hacker behind 'neverquest' malware, wanted by fbi, is arrested in spain
ruští hackeři sestřelili web fotbalového mistrovství afriky
mozilla’s first internet health report tackles security, privacy
H4
H5
H6
strong
security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech.
b
security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech.
i
em security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech.
Bolds strong 1
b 1
i 0
em 1
Zawartość strony internetowej powinno zawierać więcej niż 250 słów, z stopa tekst / kod jest wyższy niż 20%.
Pozycji używać znaczników (h1, h2, h3, ...), aby określić temat sekcji lub ustępów na stronie, ale zwykle, użyj mniej niż 6 dla każdego tagu pozycje zachować swoją stronę zwięzły.
Styl używać silnych i kursywy znaczniki podkreślić swoje słowa kluczowe swojej stronie, ale nie nadużywać (mniej niż 16 silnych tagi i 16 znaczników kursywy)

Statystyki strony

twitter:title pusty
twitter:description pusty
google+ itemprop=name pusty
Pliki zewnętrzne 8
Pliki CSS 2
Pliki javascript 6
Plik należy zmniejszyć całkowite odwołanie plików (CSS + JavaScript) do 7-8 maksymalnie.

Linki wewnętrzne i zewnętrzne

Linki 297
Linki wewnętrzne 158
Linki zewnętrzne 139
Linki bez atrybutu Title 200
Linki z atrybutem NOFOLLOW 0
Linki - Użyj atrybutu tytuł dla każdego łącza. Nofollow link jest link, który nie pozwala wyszukiwarkom boty zrealizują są odnośniki no follow. Należy zwracać uwagę na ich użytkowania

Linki wewnętrzne

- /
home /
články /node
projekty /page/projekty
hackerspace v čr /page/hackerspace-laby-v-%c4%8desk%c3%a9-republice
služby /page/slu%c5%beby-security-portalcz
security-portal.cz trička /clanky/tri%c4%8dka-security-portalcz
password generator /page/password-generator
wallpapery /category/galerie/wallpapery
konference a výstavy /page/konference-v%c3%bdstavy
virové zpravodajství /page/virov%c3%a9-zpravodajstv%c3%ad
hacking filmy /page/hacking-filmy
literatura /page/literatura-e-learning
filozofie serveru /page/filozofie-serveru-security-portalcz
přidejte se k nám! /page/p%c5%99idejte-se-k-n%c3%a1m
podpořte nás! /page/podpo%c5%99te-n%c3%a1s
rady pro psaní /filter/tips
autoři serveru /page/auto%c5%99i-serveru
mapa webu /sitemap
kontakt & irc /page/kontaktn%c3%ad-informace
analýza cíleného útoku, část první /clanky/anal%c3%bdza-c%c3%adlen%c3%a9ho-%c3%batoku-%c4%8d%c3%a1st-prvn%c3%ad
nootropika - palivo pro přetaktované mozky hackerů /clanky/nootropika-palivo-pro-p%c5%99etaktovan%c3%a9-mozky-hacker%c5%af
rozdělování ip sítí /clanky/rozd%c4%9blov%c3%a1n%c3%ad-ip-s%c3%adt%c3%ad
hackerspace laby v české republice /page/hackerspace-laby-v-%c4%8desk%c3%a9-republice
kdo je to hacker? /clanky/kdo-je-hacker
linux wallpaper 21 /image/linux-wallpaper-21
další /popular/today
další /aggregator/categories/1
upřímní rapeři byli zatčeni za carding /node/3762
anonymous odcizili osobní údaje 5400 španělských policistů /node/3761
cena uniklých dat: linkedin, thumblr, myspace /node/3760
uk: ztracené peníze z vašeho bankovního účtu? no, je to vaše vina /node/3759
cryptxxx znovu aktualizován, doposud žádné dešifrování ani po zaplacení výkupného /node/3758
další /rss-blog.xml
- javascript:dogtranslate('cs|cs')
- javascript:dogtranslate('cs|en')
- javascript:dogtranslate('cs|fr')
- javascript:dogtranslate('cs|de')
- javascript:dogtranslate('cs|it')
- javascript:dogtranslate('cs|ru')
- javascript:dogtranslate('cs|es')
blogy /blog
obrázky /image
poslední příspěvky /tracker
oblíbený obsah /popular
agregátor rss /aggregator
kategorie /aggregator/categories
aktuality /aggregator/categories/10
transhumanismus /aggregator/categories/11
zdroje /aggregator/sources
mapa webu /sitemap
dos: odmítnutí síťových služeb /clanky/dos-odm%c3%adtnut%c3%ad-s%c3%ad%c5%a5ov%c3%bdch-slu%c5%beeb
přihlašte své security projekty do akcelerátoru jic starcube /clanky/prihlaste-sve-security-projekty-do-akceleratoru-jic-starcube
hackování ženských /clanky/hackov%c3%a1n%c3%ad-%c5%beensk%c3%bdch
kód poc android botnetu s c&c využívající sms /blog/k%c3%b3d-poc-android-botnetu-s-cc-vyu%c5%be%c3%advaj%c3%adc%c3%ad-sms
konference security session 2013 - registrace spuštěna! /clanky/konference-security-session-2013-registrace-spu%c5%a1t%c4%9bna
obrázkový spam - historie a budoucnost /clanky/obr%c3%a1zkov%c3%bd-spam-historie-budoucnost
web pirateleaks.cz spuštěn! /clanky/web-pirateleakscz-spu%c5%a1t%c4%9bn
další /popular/all
security /category/tagy/security
hacking /category/tagy/hacking
konference /category/tagy/konference
programming /category/tagy/programming
sp news /category/tagy/sp-news
networks & protocols /category/tagy/networks-protocols
tisková zpráva /category/tagy/tiskov%c3%a1-zpr%c3%a1va
gnu/linux a bsd /category/tagy/gnu/linux-bsd
hacking method /category/tagy/hacking-method
anonymita /category/tagy/anonymita
exploit /category/tagy/exploit
cracking /category/tagy/cracking
více tagů /tagadelic/chunk/2
security-portal.cz - /rss.xml
sp - aktuality - /aggregator/rss/10
sp - usr blogy - /rss-blog.xml
blogy - /aggregator/rss/7
gnu/linux - /aggregator/rss/2
it news - /aggregator/rss/3
hacking - /aggregator/rss/1
exploits - /aggregator/rss/4
ars technica /aggregator/sources/79
hacking & security /aggregator/categories/1
threatpost /aggregator/sources/80
hacking & security /aggregator/categories/1
threatpost /aggregator/sources/80
hacking & security /aggregator/categories/1
threatpost /aggregator/sources/80
hacking & security /aggregator/categories/1
the hacker news /aggregator/sources/73
hacking & security /aggregator/categories/1
zive.cz - bezpečnost /aggregator/sources/76
hacking & security /aggregator/categories/1
threatpost /aggregator/sources/80
hacking & security /aggregator/categories/1
threatpost /aggregator/sources/80
hacking & security /aggregator/categories/1
sophos naked security /aggregator/sources/72
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
infosec institute resources /aggregator/sources/65
hacking & security /aggregator/categories/1
infosec institute resources /aggregator/sources/65
hacking & security /aggregator/categories/1
sophos naked security /aggregator/sources/72
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
novinky.cz - bezpečnost /aggregator/sources/75
hacking & security /aggregator/categories/1
the hacker news /aggregator/sources/73
hacking & security /aggregator/categories/1
sophos naked security /aggregator/sources/72
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
kaspersky securelist /aggregator/sources/71
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
the hacker news /aggregator/sources/73
hacking & security /aggregator/categories/1
the hacker news /aggregator/sources/73
hacking & security /aggregator/categories/1
novinky.cz - bezpečnost /aggregator/sources/75
hacking & security /aggregator/categories/1
threatpost /aggregator/sources/80
hacking & security /aggregator/categories/1
2 /aggregator/categories/1?page=1
3 /aggregator/categories/1?page=2
4 /aggregator/categories/1?page=3
5 /aggregator/categories/1?page=4
6 /aggregator/categories/1?page=5
7 /aggregator/categories/1?page=6
8 /aggregator/categories/1?page=7
9 /aggregator/categories/1?page=8
následující › /aggregator/categories/1?page=1
poslední » /aggregator/categories/1?page=50
- /aggregator/rss/1
přihlásit pomocí openid /%2523
zrušit openid přihlášení /%2523
vytvořit nový účet /user/register
zaslat nové heslo /user/password
:) o tobě psal /blog/definice-%c4%8desk%c3%a9ho-internetu-haters-haters-zase-haters#comment-595
umím zjistit skrytá čísla /clanky/lokalizace-t-mobile-sim-karet#comment-594
youtube /node/3752#comment-593
2 stejné ip adresy /clanky/rozd%c4%9blov%c3%a1n%c3%ad-ip-s%c3%adt%c3%ad#comment-592
mobisec /clanky/registrace-na-security-session-2015-spustena#comment-591
další /comments/recent
další /aggregator/categories/2
další /aggregator/categories/3
další /aggregator/categories/4
home /
články /node
projekty /page/projekty
služby /page/slu%c5%beby-security-portalcz
konference a výstavy /page/konference-v%c3%bdstavy
virové zpravodajství /page/virov%c3%a9-zpravodajstv%c3%ad
hacking filmy /page/hacking-filmy
literatura /page/literatura-e-learning
- rss.xml

Linki zewnętrzne

- https://www.facebook.com/bezpecnost.hacking.komunita
- https://twitter.com/securitycz
securix gnu/linux https://www.securix.org
postřehy z bezpečnosti http://www.root.cz/serialy/postrehy-z-bezpecnosti/#ic=serial-box&icc=title
security session konference https://www.security-session.cz/
můj soused hacker http://sousede.security-portal.cz/
cz & sk tor community http://tor.security-portal.cz/
anon / ip checker http://anoncheck.security-portal.cz/
network tools http://network-tools.security-portal.cz/
convertor http://convertor.security-portal.cz/
sp pastebin http://paste.security-portal.cz
sql injection playground http://flack.security-portal.cz/
web irc http://webirc.security-portal.cz/
virulent android malware returns, gets >2 million downloads on google play http://arstechnica.com/security/2017/01/virulent-android-malware-returns-gets-2-million-downloads-on-google-play/
apple patches critical kernel vulnerabilities http://threatpost.com/apple-patches-critical-kernel-vulnerabilities/123272/
secure email service lavabit relaunches http://threatpost.com/secure-email-service-lavabit-relaunches/123262/
heartbleed persists on 200,000 servers, devices http://threatpost.com/heartbleed-persists-on-200000-servers-devices/123253/
this bug could allow hackers to delete any video on facebook http://thehackernews.com/2017/01/delete-facebook-video.html
auto vás může šmírovat! fbi využívá bezpečnostní systémy aut pro sledování i odposlech http://www.zive.cz/clanky/auto-vas-muze-smirovat-fbi-vyuziva-bezpecnostni-systemy-aut-pro-sledovani-i-odposlech/sc-3-a-185743/default.aspx?utm_medium=selfpromo&utm_source=zive&utm_campaign=rssfeed
fórum security-portal.cz - http://forum.security-portal.cz/rss.php?mode=posts
virulent android malware returns, gets >2 million downloads on google play http://arstechnica.com/security/2017/01/virulent-android-malware-returns-gets-2-million-downloads-on-google-play/
enlarge https://cdn.arstechnica.net/wp-content/uploads/2017/01/android-malware.jpg
portal gda https://www.flickr.com/photos/135518748@n08/25123099345
family of malicious apps researchers documented in july invading non-google app markets http://arstechnica.com/security/2016/07/virulent-auto-rooting-malware-takes-control-of-10-million-android-devices/
blog post published monday http://blog.checkpoint.com/2017/01/23/hummingbad-returns/
read 6 remaining paragraphs http://arstechnica.com/security/2017/01/virulent-android-malware-returns-gets-2-million-downloads-on-google-play/#p3
comments http://arstechnica.com/security/2017/01/virulent-android-malware-returns-gets-2-million-downloads-on-google-play/?comments=1
apple patches critical kernel vulnerabilities http://threatpost.com/apple-patches-critical-kernel-vulnerabilities/123272/
secure email service lavabit relaunches http://threatpost.com/secure-email-service-lavabit-relaunches/123262/
heartbleed persists on 200,000 servers, devices http://threatpost.com/heartbleed-persists-on-200000-servers-devices/123253/
this bug could allow hackers to delete any video on facebook http://thehackernews.com/2017/01/delete-facebook-video.html
http://feeds.feedburner.com/~ff/thehackernews_com?a=nhkzoeywcl0:baho1kjtdym:yil2auoc8za
http://feeds.feedburner.com/~ff/thehackernews_com?a=nhkzoeywcl0:baho1kjtdym:qj6idk7rits
http://feeds.feedburner.com/~ff/thehackernews_com?a=nhkzoeywcl0:baho1kjtdym:gin9vfwoqvq
http://feeds.feedburner.com/~ff/thehackernews_com?a=nhkzoeywcl0:baho1kjtdym:v_sglipbpwu
http://feeds.feedburner.com/~ff/thehackernews_com?a=nhkzoeywcl0:baho1kjtdym:f7zbnmyn0lo
auto vás může šmírovat! fbi využívá bezpečnostní systémy aut pro sledování i odposlech http://www.zive.cz/clanky/auto-vas-muze-smirovat-fbi-vyuziva-bezpecnostni-systemy-aut-pro-sledovani-i-odposlech/sc-3-a-185743/default.aspx?utm_medium=selfpromo&utm_source=zive&utm_campaign=rssfeed
sage and satan ransomware, double trouble http://threatpost.com/sage-and-satan-ransomware-double-trouble/123250/
massive twitter botnet dormant since 2013 http://threatpost.com/massive-twitter-botnet-dormant-since-2013/123246/
st jude case highlights ongoing divide over ‘responsible bugs disclosure’ http://feedproxy.google.com/~r/nakedsecurity/~3/8xhydwlz1tg/
hooking and patching android apps using xposed framework http://resources.infosecinstitute.com/android-hacking-and-security-part-25-hooking-and-patching-android-apps-using-xposed-framework/
insidious gmail phishing attacks: new variants leveraging an old scheme http://resources.infosecinstitute.com/insidious-gmail-phishing-attacks-new-variants-leveraging-an-old-scheme/
israeli soldiers duped into installing malware via fake facebook profiles http://feedproxy.google.com/~r/nakedsecurity/~3/xilscpfxrwo/
francie se připravuje na kyberútoky během květnových prezidentských voleb https://www.novinky.cz/internet-a-pc/bezpecnost/427077-francie-se-pripravuje-na-kyberutoky-behem-kvetnovych-prezidentskych-voleb.html
over 199,500 websites are still vulnerable to heartbleed openssl bug http://thehackernews.com/2017/01/heartbleed-openssl-vulnerability.html
http://feeds.feedburner.com/~ff/thehackernews_com?a=n4zcpwhgwno:dqpthszixtc:yil2auoc8za
http://feeds.feedburner.com/~ff/thehackernews_com?a=n4zcpwhgwno:dqpthszixtc:qj6idk7rits
http://feeds.feedburner.com/~ff/thehackernews_com?a=n4zcpwhgwno:dqpthszixtc:gin9vfwoqvq
http://feeds.feedburner.com/~ff/thehackernews_com?a=n4zcpwhgwno:dqpthszixtc:v_sglipbpwu
http://feeds.feedburner.com/~ff/thehackernews_com?a=n4zcpwhgwno:dqpthszixtc:f7zbnmyn0lo
monday review – the hot 31 stories of the week http://feedproxy.google.com/~r/nakedsecurity/~3/smz6vsf4ddi/
expensive free apps https://securelist.com/blog/mobile/77083/expensive-free-apps/
elevenpaths https://www.elevenpaths.com/
tacyt https://www.elevenpaths.com/technology/tacyt/index.html
[1] http://blog.elevenpaths.com/2015/03/more-apps-in-google-play-subscribing-to.html
[2] http://blog.elevenpaths.com/2015/02/jsdialers-apps-calling-premium-rate.html
https://securelist.com/files/2017/01/expensive_en_1.jpg
https://securelist.com/files/2017/01/expensive_en_2.png
[3] https://www.elevenpaths.com/technology/tacyt/index.html
https://securelist.com/files/2017/01/expensive_en_3.png
https://securelist.com/files/2017/01/expensive_en_4.png
https://securelist.com/files/2017/01/expensive_en_5.png
https://securelist.com/files/2017/01/expensive_en_6.png
https://securelist.com/files/2017/01/expensive_en_7.png
https://securelist.com/files/2017/01/expensive_en_8.png
https://securelist.com/files/2017/01/expensive_en_9.png
https://www.virustotal.com/en-gb/file/cc2895442fce0145731b8e448d57e343d17ca0d4491b7fd452e6b9aaa4c2508a/analysis/ https://www.virustotal.com/en-gb/file/cc2895442fce0145731b8e448d57e343d17ca0d4491b7fd452e6b9aaa4c2508a/analysis/
http://vps237553.ovh.net/
http://vps237553.ovh.net http://vps237553.ovh.net
http://vps237553.ovh.net/nexmo/getcode.php?code= http://vps237553.ovh.net/nexmo/getcode.php?code=
http://vps237553.ovh.net/polonia/autodirect1.php http://vps237553.ovh.net/polonia/autodirect1.php
http://vps237553.ovh.net/polonia/autodirect2.php http://vps237553.ovh.net/polonia/autodirect2.php
http://vps237553.ovh.net/polonia/guardar_instalacion.php http://vps237553.ovh.net/polonia/guardar_instalacion.php
http://vps237553.ovh.net/polonia/guardar_numero.php http://vps237553.ovh.net/polonia/guardar_numero.php
http://vps237553.ovh.net/polonia/guardar_numero.php?androidid= http://vps237553.ovh.net/polonia/guardar_numero.php?androidid=
http://vps237553.ovh.net/polonia/guardar_sms.php http://vps237553.ovh.net/polonia/guardar_sms.php
http://vps237553.ovh.net/polonia/push_recibido.php http://vps237553.ovh.net/polonia/push_recibido.php
http://vps237553.ovh.net/polonia/panel.php http://vps237553.ovh.net/polonia/panel.php
http://vps237553.ovh.net/nexmo/ http://vps237553.ovh.net/nexmo/
https://securelist.com/files/2017/01/expensive_en_10.png
104.238.188.38 https://www.virustotal.com/en/ip-address/104.238.188.38/information/
45.32.236.127 https://www.virustotal.com/en/ip-address/45.32.236.127/information/
51.255.199.164 https://www.virustotal.com/en/ip-address/51.255.199.164/information/
50.63.202.50 https://www.virustotal.com/en/ip-address/50.63.202.50/information/
45.63.85.198 https://www.virustotal.com/en/ip-address/45.63.85.198/information/
51.255.199.164 https://www.virustotal.com/en/ip-address/51.255.199.164/information/
https://securelist.com/files/2017/01/expensive_en_11.png
https://securelist.com/files/2017/01/expensive_en_12.png
source code for another android banking malware leaked http://thehackernews.com/2017/01/android-banking-malware.html
http://feeds.feedburner.com/~ff/thehackernews_com?a=mlbo0ejbgae:kqsbynezoo8:yil2auoc8za
http://feeds.feedburner.com/~ff/thehackernews_com?a=mlbo0ejbgae:kqsbynezoo8:qj6idk7rits
http://feeds.feedburner.com/~ff/thehackernews_com?a=mlbo0ejbgae:kqsbynezoo8:gin9vfwoqvq
http://feeds.feedburner.com/~ff/thehackernews_com?a=mlbo0ejbgae:kqsbynezoo8:v_sglipbpwu
http://feeds.feedburner.com/~ff/thehackernews_com?a=mlbo0ejbgae:kqsbynezoo8:f7zbnmyn0lo
russian hacker behind 'neverquest' malware, wanted by fbi, is arrested in spain http://thehackernews.com/2017/01/neverquest-fbi-hacker.html
http://feeds.feedburner.com/~ff/thehackernews_com?a=lhdb3z6j4pi:p6fcozk39uc:yil2auoc8za
http://feeds.feedburner.com/~ff/thehackernews_com?a=lhdb3z6j4pi:p6fcozk39uc:qj6idk7rits
http://feeds.feedburner.com/~ff/thehackernews_com?a=lhdb3z6j4pi:p6fcozk39uc:gin9vfwoqvq
http://feeds.feedburner.com/~ff/thehackernews_com?a=lhdb3z6j4pi:p6fcozk39uc:v_sglipbpwu
http://feeds.feedburner.com/~ff/thehackernews_com?a=lhdb3z6j4pi:p6fcozk39uc:f7zbnmyn0lo
ruští hackeři sestřelili web fotbalového mistrovství afriky https://www.novinky.cz/internet-a-pc/bezpecnost/427144-rusti-hackeri-sestrelili-web-fotbaloveho-mistrovstvi-afriky.html
mozilla’s first internet health report tackles security, privacy http://threatpost.com/mozillas-first-internet-health-report-tackles-security-privacy/123235/
co je openid? http://openid.net/
- http://www.stech.cz/konference/ict.aspx
- http://cryptofest.cz/?node=program
- http://www.security-session.cz
-
-
-
-
-
-
http://www.itsw.cz
- http://idc-czech.cz/cze/konference/56985-idc-cloud-computing-conference-2014/7-overview
- http://www.bezpecnostvcloudu.cz
- http://idc-cema.com/eng/events/56335-idc-it-security-roadshow-2014?g_clang=cze
- http://www.europen.cz
- http://www.planujakci.cz/
- http://brmlab.cz
http://www.ceskapiratskastrana.cz
- http://bflow.security-portal.cz/
- http://secit.sk/
http://www.blackhole.sk
- http://www.skodlivysoftware.cz/
http://www.viry.cz
- http://hack4fun.eu/
jak vytvořit chatbot ve službě conversation na platformě bluemix od ibm? http://www.abclinuxu.cz/clanky/jak-vytvorit-chatbot-ve-sluzbe-conversation-na-platforme-bluemix-od-ibm
tinker board, konkurence raspberry pi 3 od asusu http://www.abclinuxu.cz/zpravicky/tinker-board-konkurence-raspberry-pi-3-od-asusu
pravidla hackerské soutěže pwn2own 2017 zveřejněna, útočit se bude i na ubuntu http://www.abclinuxu.cz/zpravicky/pravidla-hackerske-souteze-pwn2own-2017-zverejnena-utocit-se-bude-i-na-ubuntu
program konference prague postgresql developer days 2017 http://www.abclinuxu.cz/zpravicky/program-konference-prague-postgresql-developer-days-2017
lednový prague containes meetup http://www.abclinuxu.cz/zpravicky/lednovy-prague-containes-meetup
auto vás může šmírovat! fbi využívá bezpečnostní systémy aut pro sledování i odposlech http://www.zive.cz/clanky/auto-vas-muze-smirovat-fbi-vyuziva-bezpecnostni-systemy-aut-pro-sledovani-i-odposlech/sc-3-a-185743/default.aspx
microsoft pokračuje v propouštění, do konce měsíce přijde o místo dalších 700 lidí, převážně z nokie http://connect.zive.cz/bleskovky/microsoft-pokracuje-vpropousteni-do-konce-mesice-prijde-o-misto-dalsich-700-lidi-prevazne-z-nokie/sc-321-a-185744/default.aspx
závěry šetření hořících galaxy note 7: náhradní baterie byly horší než původní http://diit.cz/clanek/galaxy-note-7-vysledky-vysetrovani#utm_source=atom&utm_medium=feed&utm_content=article
umělá inteligence zvládne test inteligence pomocí obrazců lépe než 75 % američanů http://connect.zive.cz/bleskovky/umela-inteligence-zvladne-test-inteligence-pomoci-obrazcu-lepe-nez-75--americanu/sc-321-a-185742/default.aspx
prohlédněte si detailní mikrosnímek jádra xbox one http://diit.cz/clanek/podivejte-se-na-jadro-xbox-one#utm_source=atom&utm_medium=feed&utm_content=article
telstra 4gx portable router persistent root shell http://www.intelligentexploit.com/view-details.html?id=25777
oracle e-business suite 12.x unconstrainted file download http://www.intelligentexploit.com/view-details.html?id=25778
emc avamar data store / virtual edition 7.3.1 / 7.3.0 privilege escalation http://www.intelligentexploit.com/view-details.html?id=25779
oracle openjdk runtime environment build 1.8.0_112-b15 denial of service http://www.intelligentexploit.com/view-details.html?id=25780
oracle peoplesoft hcm 9.2 cross site scripting http://www.intelligentexploit.com/view-details.html?id=25781
- http://creativecommons.org/licenses/by-sa/3.0/
creative commons attribution-share alike 3.0 unported license http://creativecommons.org/licenses/by-sa/3.0/
- http://drupal.org
dr. radut http://www.radut.net/

Zdjęcia

Zdjęcia 40
Zdjęcia bez atrybutu ALT 11
Zdjęcia bez atrybutu TITLE 36
Korzystanie Obraz ALT i TITLE atrybutu dla każdego obrazu.

Zdjęcia bez atrybutu TITLE

/sites/default/files/images/facebook-button.gif
/sites/default/files/images/twitter-sp.gif
/sites/default/files/salamander12-white_logo.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
http://www.security-portal.cz/sites/default/files/securitysessionbanner.gif
http://www.expo-net.cz/foto/loga_nase/o-logo_itsw.jpg
/sites/default/files/idc-cc-120x60-cz.gif
http://www.bezpecnostvcloudu.cz/files/clanky/ikonka_bvc.gif
/sites/default/files/idc.gif
http://www.security-portal.cz/sites/default/files/europen.png
http://www.security-portal.cz/img/logo/planujakci/planujakci-cz-4.gif
http://www.security-portal.cz/img/logo/brmlab/brmlab.gif
http://www.ceskapiratskastrana.cz/media/grafika/cps_banner_88x31_whitebg.gif
http://bflow.security-portal.cz/banner/banner2.gif
http://www.security-portal.cz/img/logo/secit/secit.png
http://www.security-portal.cz/img/logo/blackhole/blackhole1.gif
http://www.skodlivysoftware.cz/images/banner.gif
http://www.security-portal.cz/img/logo/viry/viry_cz.gif
http://www.security-portal.cz/img/logo/hack4fun/hack4fun-banner1.jpg
http://i.creativecommons.org/l/by-sa/3.0/80x15.png
/misc/feed.png

Zdjęcia bez atrybutu ALT

/sites/default/files/images/facebook-button.gif
/sites/default/files/images/twitter-sp.gif
http://www.stech.cz/portals/0/konference/2015/06%20ict/90x60.gif
/sites/default/files/images/cryptofest.png
http://www.security-portal.cz/sites/default/files/securitysessionbanner.gif
http://www.expo-net.cz/foto/loga_nase/o-logo_itsw.jpg
http://www.bezpecnostvcloudu.cz/files/clanky/ikonka_bvc.gif
/sites/default/files/idc.gif
http://www.security-portal.cz/sites/default/files/europen.png
http://www.security-portal.cz/img/logo/planujakci/planujakci-cz-4.gif
http://bflow.security-portal.cz/banner/banner2.gif

Ranking:


Alexa Traffic
Daily Global Rank Trend
Daily Reach (Percent)









Majestic SEO











Text on page:

hledat na tomto webu: každý člověk, kterému záleží jen na jedné věci, je nebezpečný. — g. k. chesterton menu home články projektysecurix gnu/linux postřehy z bezpečnosti security session konference hackerspace v čr můj soused hacker cz & sk tor community službyanon / ip checker network tools convertor security-portal.cz trička sp pastebin password generator sql injection playground web irc wallpapery konference a výstavy virové zpravodajství hacking filmy literatura filozofie serveru přidejte se k nám! podpořte nás! rady pro psaní autoři serveru mapa webu kontakt & irc dnešní oblíbený obsah analýza cíleného útoku, část první (204) nootropika - palivo pro přetaktované mozky hackerů (80) rozdělování ip sítí (46) hackerspace laby v české republice (25) kdo je to hacker? (22) linux wallpaper 21 (20) další aktuality virulent android malware returns, gets >2 million downloads on google play apple patches critical kernel vulnerabilities secure email service lavabit relaunches heartbleed persists on 200,000 servers, devices this bug could allow hackers to delete any video on facebook auto vás může šmírovat! fbi využívá bezpečnostní systémy aut pro sledování i odposlech další nejnovější příspěvky blogu upřímní rapeři byli zatčeni za carding anonymous odcizili osobní údaje 5400 španělských policistů cena uniklých dat: linkedin, thumblr, myspace uk: ztracené peníze z vašeho bankovního účtu? no, je to vaše vina cryptxxx znovu aktualizován, doposud žádné dešifrování ani po zaplacení výkupného další select languageczechafrikaansalbanianarabicbelarusianbulgariancatalanchinese (simplified)chinese (traditional)croatiandanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish navigace blogy obrázky poslední příspěvky oblíbený obsah agregátor rsskategorieaktuality transhumanismus zdroje mapa webu náhodný obsah dos: odmítnutí síťových služeb (17,115) přihlašte své security projekty do akcelerátoru jic starcube (7,310) hackování ženských (24,176) kód poc android botnetu s c&c využívající sms (19,659) konference security session 2013 - registrace spuštěna! (11,671) obrázkový spam - historie a budoucnost (16,729) web pirateleaks.cz spuštěn! (11,781) další tagy security hacking konference programming sp news networks & protocols tisková zpráva gnu/linux a bsd hacking method anonymita exploit cracking více tagů rss feed security-portal.cz sp - aktuality sp - usr blogy fórum security-portal.cz rss feed aggregator: blogy gnu/linux it news hacking exploits security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech. kategorie virulent android malware returns, gets >2 million downloads on google play ars technica - 1 hodina 1 min zpět enlarge (credit: portal gda) a virulent family of malware that infected more than 10 million android devices last year has made a comeback, this time hiding inside google play apps that have been downloaded by as many as 12 million unsuspecting users. hummingwhale, as the professionally developed malware has been dubbed, is a variant of hummingbad, the name given to a family of malicious apps researchers documented in july invading non-google app markets. hummingbad attempted to override security protections by exploiting unpatched vulnerabilities that gave the malware root privileges in older versions of android. before google shut it down, it installed more than 50,000 fraudulent apps each day, displayed 20 million malicious advertisements, and generated more than $300,000 per month in revenue. of the 10 million people who downloaded hummingbad-contaminated apps, an estimated 286,000 of them were located in the us. hummingwhale, by contrast, managed to sneak its way into about 20 google play apps that were downloaded from 2 million to 12 million times, according to researchers from check point, the security company that has been closely following the malware family for almost a year. rather than rooting devices, the latest variant includes new virtual machine techniques that allow the malware to perform ad fraud better than ever, company researchers said in a blog post published monday. read 6 remaining paragraphs | comments kategorie: hacking & security apple patches critical kernel vulnerabilities threatpost - 1 hodina 4 min zpět apple released updates across its product lines, including ios 10.2.1, patching a number of critical code execution vulnerabilities in the kernel, libarchive and webkit. kategorie: hacking & security secure email service lavabit relaunches threatpost - 2 hodiny 49 min zpět lavabit, the secure email provider that suspended operations back in 2013 after the us government asked for its users ssl keys, relaunched friday under a new architecture. kategorie: hacking & security heartbleed persists on 200,000 servers, devices threatpost - 4 hodiny 9 min zpět almost 200,000 servers are still vulnerable to heartbleed, the openssl vulnerability patched nearly three years ago. kategorie: hacking & security this bug could allow hackers to delete any video on facebook the hacker news - 4 hodiny 13 min zpět a security researcher has discovered a critical vulnerability in facebook that could allow attackers to delete any video of the social networking site shared by anyone on their wall. the flaw has been discovered by security researcher dan melamed in june 2016, allowing him not only to remotely delete any video on facebook shared by anyone without having any permission or authentication but kategorie: hacking & security auto vás může šmírovat! fbi využívá bezpečnostní systémy aut pro sledování i odposlech zive.cz - bezpečnost - 4 hodiny 40 min zpět ** bezpečnostní systémy automobilů umožňují získat polohu kradeného vozidla nebo dokonce vypnout motor ** ty stejné systémy ale lze použít ke sledování a odposlechu ** fbi tyto možnost již několik let využívá kategorie: hacking & security sage and satan ransomware, double trouble threatpost - 6 hodin 40 min zpět a spam campaign has started spreading sage ransomware, while a ransomware service known as satan allows users to customize distribution. kategorie: hacking & security massive twitter botnet dormant since 2013 threatpost - 8 hodin 48 min zpět researchers from the university college london have found a twitter botnet of 350,000 bots that has been dormant since shortly after the accounts were registered. kategorie: hacking & security st jude case highlights ongoing divide over ‘responsible bugs disclosure’ sophos naked security - 8 hodin 50 min zpět disclosing bugs and vulnerabilities is 'the free market kategorie: hacking & security, viry a červi hooking and patching android apps using xposed framework infosec institute resources - 9 hodin 40 min zpět introduction: in part 22 of this series, we discussed the tools that control the flow of the application on the fly while the app is running. writing cydia substrate extensions to control the application flow is what we discussed there. in this article, we are going to use xposed framework on the same target application […] kategorie: hacking & security insidious gmail phishing attacks: new variants leveraging an old scheme infosec institute resources - 9 hodin 40 min zpět the recent gmail phishing attacks recently security experts warned of a new insidious gmail phishing campaign that can also trick tech-savvy people. cyber-criminals leverage specially crafted urls to trick victims into providing their gmail credentials via a phishing page. victims receive a malicious an email from one of their contacts; the message pretends to carry a pdf document […] kategorie: hacking & security israeli soldiers duped into installing malware via fake facebook profiles sophos naked security - 10 hodin 19 min zpět hamas used one of the oldest tricks in the social engineering book to dupe idf soldiers kategorie: hacking & security, viry a červi francie se připravuje na kyberútoky během květnových prezidentských voleb novinky.cz - bezpečnost - 11 hodin 26 min zpět nejen německo se obává narušení voleb, o které se při loňském výběru nového prezidenta spojených států pokusili hackeři z ruska. v pohotovosti je i francie. kategorie: hacking & security over 199,500 websites are still vulnerable to heartbleed openssl bug the hacker news - 12 hodin 4 min zpět it's more than two and half years since the discovery of the critical openssl heartbleed vulnerability, but the flaw is still alive as it appears that many organizations did not remediate properly to the serious security glitch. it was one of the biggest flaws in the internet's history that affected the core security of as many as two-thirds of the world's servers i.e. half a million servers at kategorie: hacking & security monday review – the hot 31 stories of the week sophos naked security - 12 hodin 15 min zpět from the sysadmin sued for wiping school's gmail login to the end of patch tuesday to trump's new cybersecurity advisor, and much more! kategorie: hacking & security, viry a červi expensive free apps kaspersky securelist - 13 hodin 1 min zpět this post is the result of collaboration between elevenpaths (telefónica cyber security unit) and kaspersky lab. both companies have used their own expertise, researchers and tools, such as tacyt (an innovative tool for the monitoring and analysis of mobile threats) and great’s internal tools and resources. big brother and google play fraudulent apps trying to send premium sms messages or trying to call to high rate phone numbers are not something new. actually, it is easy to find them specially in spain, russia and some other european countries. of course, it is much more interesting to talk about how certain groups bypass detection mechanisms such as those used by google play, since this has become difficult to achieve in the past few years. some years ago it was pretty easy to upload a dialer (or other similar fraudulent app) to google play [1] [2], but new detection mechanisms made attacker to focus on alternative markets, at least for a period of time. recently, we have found a spanish group that successfully uploaded a non-official big brother (gran hermano) tv show app, which is one of the most popular tv shows in spain even being on the air for 16 years now. [analysis:cdd254ee6310331a82e96f32901c67c74ae12425] this was not a very sophisticated app, but they were able to upload it into google play using an old trick. first, they uploaded a clean an innocuous version that of course passed or the security controls from google play. then, some days later, a new version was uploaded with a major features update, including subscription to paying services. this trick was extremely simple but successful, since the app was in the google play for around two months (from mid september to mid november 2015). it seems this was not the first time this group tried to upload a big brother-like app. we have detected (via tacyt [3]) at least another 4 similar applications that, regarding some particular logging messages we found in the code, could have the same origin: com.granhermano.gh16_1; from 2015-09-15 to 2015-09-22; com.granhermano162; from 2015-09-29 to 2015-11-14; com.granhermanodieciseis; from 2015-09-29 to 2015-11-11 com.granh.gh16_3; from 2015-10-05 to 2015-10-15; com.hisusdk; from 2015-09-16 to 2015-11-14 (the one analyzed). as we said before, this group was found to be using a specific string “caca” as a logging tag, which is not something usual: the word “caca” is a colloquial word in spanish referring to an excrement (very similar to the word “poo” in english). we could find it in certain testing code, referring to lines of code that should be removed later, but it is unusual to find it in such similar applications and used in the same way. because of that, it makes sense to think that those applications were developed by the same group. other strings and function names used in the code make us conclude that those applications could be developer by native spanish speakers. this app is using several commercial third party services such as parse.com for the first network communication. this first api call is used in order to get all the information necessary to run further actions (urls, authentication, etc). {“results”:[{“funcionamiento”:” ahora la única pestaña importante es la de vot.”,”action1″:”http://tempuri.org/getpincode”,”action2″:”http://tempuri.org/crearsubscripcion”,”activa”:”si”,”createdat”:”2015-09-08t16:17:24.550z”,”estado”:true,”id_categoria”:”2608″,”id_subscripcion”:”400″,”metodo1″:”getpincode”,”metodo2″:”crearsubscripcion”,”namespace”:”http://tempuri.org/”,”nombreapp”:”gh16 – españa”,”numero_corto”:”795059″,”numero_sms”:”+34911067088″,”objectid”:”tnrezkeocz”,”password”:”15xw7v7u”,”updatedat”:”2015-11-27t10:28:00.406z”,”url”:”http://ws.alertas.aplicacionesmonsan.net/websubscription.asmx?wsdl”,”urlcode”:”http://spamea.me/getcode.php?code=”,”usuario”:”yourmob”,”vot”:true}]} as we can see above, it references to different urls: spamea.me is service that no longer exists at the time of writing, but that used to be hosted on 107.6.184.212, which seems a hosting service shared with many other websites. ws.alertas.aplicacionesmonsan.net is legitimate service focused on mobile monetization, including sms premium and direct carrier billing. it is used from the app in order to subscribe the user to a service called “yourmob.com”. of course, using paying services is not malicious itself, since it is legitimate that companies could bill for their services, but user should be clearly noticed about service cost and conditions beforehand. despite we found a reference to “terms and conditions” (in spanish) poiting to the website servimob.com , we could not verify that this information is shown to users and, anyway, users don’t have the opportunity to reject the agreement and don’t be subscribed. presence outside google play it make sense that if a group have included this kind of app in google play, they were going to try something similar using other app sources (thanks to facundo j. sánchez that spotted this). analysis: 9b47070e65f81d253c2452edc5a0eb9cd17447f4 this app worked slightly different. it uses other 3rd party services and it sends premium smss for monetization. they got from the server what number to use, for how many seconds and if the screen should be on or off. we found that they used very similar words for comments and method names (most of them in spanish, including “caca”), same topic (big brother), references to “yourmob” and much more, so definitely we can link it with the spanish group mentioned before. one of the webservices used by this application (http://104.238.188.38/806/) exposed a control panel showing information about people using this app: as you probably know, groups developing this kind of apps usually reuse their servers and supporting infrastructure for multiple apps, for example this one: https://www.virustotal.com/en-gb/file/cc2895442fce0145731b8e448d57e343d17ca0d4491b7fd452e6b9aaa4c2508a/analysis/ it was using this vps as well http://vps237553.ovh.net. some of the panels and services provided by the vps were located here: http://vps237553.ovh.net/nexmo/getcode.php?code= http://vps237553.ovh.net/polonia/autodirect1.php http://vps237553.ovh.net/polonia/autodirect2.php http://vps237553.ovh.net/polonia/guardar_instalacion.php http://vps237553.ovh.net/polonia/guardar_numero.php http://vps237553.ovh.net/polonia/guardar_numero.php?androidid= http://vps237553.ovh.net/polonia/guardar_sms.php http://vps237553.ovh.net/polonia/push_recibido.php http://vps237553.ovh.net/polonia/panel.php http://vps237553.ovh.net/nexmo/ as we can see in their control panel, they have been quite successful in terms of spread, since there are registered phones from many different countries (spain, holland, poland, etc). in addition, an iterative search on terms such as ip addresses, unique paths, etc, has shown that other apps could be using the same supporting infrastructure that was shown above, including the following ip addresses and domain names: 104.238.188.38 45.32.236.127 51.255.199.164 (vps237553.ovh.net) 50.63.202.50 45.63.85.198 in particular, 45.32.236.127 was pointed by different domain names in the past months: kongwholesaler.tk (2016-05-22) acc-facebook.com (2016-04-11) h-instagram.com (2016-04-11) msg-vk.com (2016-04-11) msg-google.ru (2016-04-10) msg-mail.ru (2016-04-10) iwantbitcoins.xyz (2015-11-04) these domains have probably been used for fraudulent initiatives such as phishing attacks, since they are very similar to well-known and legitimate services. something that kept our attention was that “vps237553.ovh.net”, used from a sample and resolving to 51.255.199.164, was also used at some point (june 2016 regarding our passive dns) by “servimob.com” domain (same domain referenced in the app from google play). back to google play as you can imagine, they tried again to upload a new app to google play, following a similar philosophy and techniques that we have seen before. e49faf379b827ee8d3a777e69f3f9bd3e559ba03 11a131c23e6427dd7e0e47280dd8f421febdc4f7 these apps were available in google play for a few weeks in september 2016, using similar techniques, especially to those applications that we found outside google play. conclusions this spanish group has been quite successful on uploading this kind of apps in google play, using interesting topics such as the big brother tv show. spain and poland have been two countries traditionally targeted by sms scams and similar malware. however, we have never seen in the past few years any group that was able to upload apps to legitimate markets in such an easy way. perhaps the key point is that they try to be close enough to the border between a legitimate business and a malicious one. kategorie: hacking & security, viry a červi source code for another android banking malware leaked the hacker news - 13 hodin 35 min zpět another bad news for android users — source code for another android banking malware has been leaked online via an underground hacking forum. this newly discovered banking trojan is designed to steal money from bank accounts of android devices' owners by gaining administrator privileges on their smartphones. apparently, it will attract the attention of many cyber criminals who can recompile kategorie: hacking & security russian hacker behind 'neverquest' malware, wanted by fbi, is arrested in spain the hacker news - 22 leden, 2017 - 10:09 a russian computer hacker wanted by the fbi on hacking allegations was arrested and jailed in spain earlier this week, while a decision on his extradition to the united states has yet to be made. the guardia civil, spanish law enforcement agency officers, have detained 32-year-old stanislav lisov at barcelona–el prat airport based on an international arrest warrant issued by interpol at the kategorie: hacking & security ruští hackeři sestřelili web fotbalového mistrovství afriky novinky.cz - bezpečnost - 22 leden, 2017 - 07:47 skupina ruských hackerů se v sobotu přihlásila k tomu, že vyřadila z provozu internetové stránky probíhajícího fotbalového mistrovství afriky. protestují tak proti tomu, že se turnaj koná v gabonu, kde se po loňských volbách a následných nepokojích drží u moci prezident ali bongo. kategorie: hacking & security mozilla’s first internet health report tackles security, privacy threatpost - 21 leden, 2017 - 15:00 mozilla released its first internet health report, examining the dangers of over-sharing eroding privacy, and the security of connected devices. kategorie: hacking & security 1 2 3 4 5 6 7 8 9 … následující › poslední » přihlášení přihlásit pomocí openid: co je openid? uživatelské jméno: * heslo: * přihlásit pomocí openid zrušit openid přihlášení vytvořit nový účet zaslat nové heslo poslední komentáře :) o tobě psal před 12 týdnů 2 dny umím zjistit skrytá čísla před 20 týdnů 6 dnů youtube před 34 týdny 6 dnů 2 stejné ip adresy před 38 týdnů 6 dnů mobisec před 48 týdnů 10 hodin další konference doporučujeme gnu/linux & bsd jak vytvořit chatbot ve službě conversation na platformě bluemix od ibm? tinker board, konkurence raspberry pi 3 od asusu pravidla hackerské soutěže pwn2own 2017 zveřejněna, útočit se bude i na ubuntu program konference prague postgresql developer days 2017 lednový prague containes meetup další it news auto vás může šmírovat! fbi využívá bezpečnostní systémy aut pro sledování i odposlech microsoft pokračuje v propouštění, do konce měsíce přijde o místo dalších 700 lidí, převážně z nokie závěry šetření hořících galaxy note 7: náhradní baterie byly horší než původní umělá inteligence zvládne test inteligence pomocí obrazců lépe než 75 % američanů prohlédněte si detailní mikrosnímek jádra xbox one další security vulnerabilities & exploits telstra 4gx portable router persistent root shell oracle e-business suite 12.x unconstrainted file download emc avamar data store / virtual edition 7.3.1 / 7.3.0 privilege escalation oracle openjdk runtime environment build 1.8.0_112-b15 denial of service oracle peoplesoft hcm 9.2 cross site scripting další home články projekty služby konference a výstavy virové zpravodajství hacking filmy literatura this work is licensed under a creative commons attribution-share alike 3.0 unported license. cc-by-sa security-portal.cz | secured by paranoid sense | we hack to learn by dr. radut


Here you find all texts from your page as Google (googlebot) and others search engines seen it.

Words density analysis:

Numbers of all words: 3119

One word

Two words phrases

Three words phrases

the - 4.36% (136)
and - 1.7% (53)
hack - 1.51% (47)
security - 1.44% (45)
app - 1.41% (44)
his - 1.22% (38)
that - 1.12% (35)
for - 0.99% (31)
pro - 0.96% (30)
min - 0.93% (29)
this - 0.9% (28)
use - 0.9% (28)
hacking - 0.9% (28)
are - 0.83% (26)
ani - 0.74% (23)
all - 0.74% (23)
kategorie - 0.71% (22)
one - 0.67% (21)
google - 0.67% (21)
kategorie: - 0.64% (20)
play - 0.64% (20)
per - 0.61% (19)
hodin - 0.58% (18)
new - 0.58% (18)
any - 0.58% (18)
from - 0.58% (18)
zpět - 0.55% (17)
service - 0.55% (17)
other - 0.51% (16)
ali - 0.48% (15)
vps - 0.48% (15)
hacker - 0.48% (15)
own - 0.48% (15)
was - 0.48% (15)
used - 0.48% (15)
not - 0.45% (14)
have - 0.45% (14)
apps - 0.45% (14)
our - 0.45% (14)
code - 0.45% (14)
tor - 0.42% (13)
has - 0.38% (12)
aut - 0.38% (12)
web - 0.38% (12)
malware - 0.38% (12)
ars - 0.35% (11)
using - 0.35% (11)
android - 0.35% (11)
but - 0.32% (10)
při - 0.32% (10)
some - 0.32% (10)
been - 0.32% (10)
group - 0.32% (10)
similar - 0.32% (10)
post - 0.32% (10)
how - 0.32% (10)
že - 0.29% (9)
2016 - 0.29% (9)
over - 0.29% (9)
sms - 0.29% (9)
application - 0.29% (9)
year - 0.29% (9)
server - 0.29% (9)
bezpečnost - 0.29% (9)
they - 0.29% (9)
could - 0.29% (9)
get - 0.29% (9)
další - 0.29% (9)
upload - 0.29% (9)
spanish - 0.29% (9)
million - 0.29% (9)
work - 0.26% (8)
were - 0.26% (8)
services - 0.26% (8)
news - 0.26% (8)
user - 0.26% (8)
since - 0.26% (8)
search - 0.26% (8)
their - 0.26% (8)
two - 0.26% (8)
such - 0.26% (8)
konference - 0.22% (7)
patch - 0.22% (7)
ale - 0.22% (7)
its - 0.22% (7)
found - 0.22% (7)
more - 0.22% (7)
auto - 0.22% (7)
than - 0.22% (7)
many - 0.22% (7)
book - 0.22% (7)
show - 0.22% (7)
same - 0.22% (7)
researcher - 0.22% (7)
old - 0.22% (7)
dnů - 0.22% (7)
name - 0.22% (7)
threatpost - 0.19% (6)
download - 0.19% (6)
time - 0.19% (6)
users - 0.19% (6)
years - 0.19% (6)
servers - 0.19% (6)
fbi - 0.19% (6)
portal - 0.19% (6)
big - 0.19% (6)
see - 0.19% (6)
you - 0.19% (6)
linux - 0.19% (6)
names - 0.19% (6)
word - 0.19% (6)
first - 0.19% (6)
able - 0.19% (6)
vulnerabilities - 0.19% (6)
spain - 0.19% (6)
allow - 0.19% (6)
devices - 0.19% (6)
facebook - 0.19% (6)
can - 0.19% (6)
systémy - 0.19% (6)
source - 0.19% (6)
legitimate - 0.16% (5)
fraud - 0.16% (5)
blog - 0.16% (5)
security, - 0.16% (5)
part - 0.16% (5)
control - 0.16% (5)
bank - 0.16% (5)
gmail - 0.16% (5)
including - 0.16% (5)
applications - 0.16% (5)
před - 0.16% (5)
trick - 0.16% (5)
tool - 0.16% (5)
very - 0.16% (5)
sage - 0.16% (5)
site - 0.16% (5)
2017 - 0.16% (5)
internet - 0.16% (5)
domain - 0.16% (5)
end - 0.16% (5)
brother - 0.16% (5)
let - 0.16% (5)
phishing - 0.16% (5)
via - 0.16% (5)
hackers - 0.16% (5)
security-portal.cz - 0.16% (5)
bug - 0.16% (5)
heartbleed - 0.16% (5)
malicious - 0.16% (5)
researchers - 0.16% (5)
secure - 0.16% (5)
before - 0.16% (5)
exploit - 0.16% (5)
critical - 0.16% (5)
way - 0.13% (4)
tools - 0.13% (4)
gnu/linux - 0.13% (4)
market - 0.13% (4)
russia - 0.13% (4)
sledování - 0.13% (4)
most - 0.13% (4)
týdnů - 0.13% (4)
cyber - 0.13% (4)
email - 0.13% (4)
bad - 0.13% (4)
network - 0.13% (4)
video - 0.13% (4)
successful - 0.13% (4)
panel - 0.13% (4)
about - 0.13% (4)
viry - 0.13% (4)
červi - 0.13% (4)
past - 0.13% (4)
openid - 0.13% (4)
into - 0.13% (4)
analysis - 0.13% (4)
those - 0.13% (4)
people - 0.13% (4)
spam - 0.13% (4)
different - 0.13% (4)
point - 0.13% (4)
bezpečnostní - 0.13% (4)
test - 0.13% (4)
another - 0.13% (4)
reference - 0.13% (4)
odposlech - 0.13% (4)
hodiny - 0.13% (4)
využívá - 0.13% (4)
law - 0.13% (4)
rate - 0.13% (4)
delete - 0.13% (4)
ssl - 0.13% (4)
something - 0.13% (4)
fraudulent - 0.13% (4)
try - 0.13% (4)
with - 0.13% (4)
sources - 0.13% (4)
play, - 0.13% (4)
banking - 0.1% (3)
blogy - 0.1% (3)
message - 0.1% (3)
vás - 0.1% (3)
může - 0.1% (3)
(2016-04-11) - 0.1% (3)
much - 0.1% (3)
šmírovat! - 0.1% (3)
order - 0.1% (3)
week - 0.1% (3)
- 0.1% (3)
jen - 0.1% (3)
few - 0.1% (3)
countries - 0.1% (3)
kind - 0.1% (3)
information - 0.1% (3)
run - 0.1% (3)
make - 0.1% (3)
virulent - 0.1% (3)
sense - 0.1% (3)
should - 0.1% (3)
obsah - 0.1% (3)
“caca” - 0.1% (3)
direct - 0.1% (3)
webu - 0.1% (3)
website - 0.1% (3)
shown - 0.1% (3)
and, - 0.1% (3)
apple - 0.1% (3)
course - 0.1% (3)
premium - 0.1% (3)
version - 0.1% (3)
kernel - 0.1% (3)
even - 0.1% (3)
which - 0.1% (3)
uploaded - 0.1% (3)
lavabit - 0.1% (3)
following - 0.1% (3)
specially - 0.1% (3)
200,000 - 0.1% (3)
terms - 0.1% (3)
find - 0.1% (3)
easy - 0.1% (3)
phone - 0.1% (3)
call - 0.1% (3)
urls - 0.1% (3)
markets - 0.1% (3)
poslední - 0.1% (3)
made - 0.1% (3)
flaw - 0.1% (3)
dan - 0.1% (3)
variant - 0.1% (3)
nový - 0.1% (3)
downloaded - 0.1% (3)
pomocí - 0.1% (3)
while - 0.1% (3)
shared - 0.1% (3)
ransomware - 0.1% (3)
- 0.1% (3)
botnet - 0.1% (3)
family - 0.1% (3)
sophos - 0.1% (3)
naked - 0.1% (3)
hummingbad - 0.1% (3)
root - 0.1% (3)
tak - 0.1% (3)
who - 0.1% (3)
techniques - 0.1% (3)
privilege - 0.1% (3)
read - 0.1% (3)
file - 0.1% (3)
them - 0.1% (3)
oracle - 0.1% (3)
number - 0.1% (3)
discovered - 0.1% (3)
back - 0.1% (3)
month - 0.1% (3)
under - 0.1% (3)
still - 0.1% (3)
openssl - 0.1% (3)
vulnerability - 0.1% (3)
program - 0.1% (3)
prezident - 0.1% (3)
aktuality - 0.1% (3)
xposed - 0.1% (3)
resources - 0.1% (3)
leden, - 0.1% (3)
projekty - 0.1% (3)
bsd - 0.1% (3)
arrest - 0.1% (3)
russian - 0.1% (3)
attacks - 0.1% (3)
rss - 0.1% (3)
2013 - 0.1% (3)
going - 0.1% (3)
recent - 0.1% (3)
irc - 0.06% (2)
než - 0.06% (2)
don’t - 0.06% (2)
business - 0.06% (2)
close - 0.06% (2)
outside - 0.06% (2)
konce - 0.06% (2)
key - 0.06% (2)
prague - 0.06% (2)
analysis: - 0.06% (2)
mapa - 0.06% (2)
arrested - 0.06% (2)
never - 0.06% (2)
topic - 0.06% (2)
servimob.com - 0.06% (2)
bill - 0.06% (2)
inteligence - 0.06% (2)
články - 0.06% (2)
wallpaper - 0.06% (2)
hackerů - 0.06% (2)
3.0 - 0.06% (2)
home - 0.06% (2)
služby - 0.06% (2)
cross - 0.06% (2)
etc). - 0.06% (2)
above, - 0.06% (2)
leaked - 0.06% (2)
references - 0.06% (2)
sql - 0.06% (2)
spamea.me - 0.06% (2)
ws.alertas.aplicacionesmonsan.net - 0.06% (2)
oblíbený - 0.06% (2)
wanted - 0.06% (2)
subscribe - 0.06% (2)
conditions - 0.06% (2)
poland - 0.06% (2)
výstavy - 0.06% (2)
link - 0.06% (2)
phones - 0.06% (2)
(2016-04-10) - 0.06% (2)
mistrovství - 0.06% (2)
there - 0.06% (2)
mozilla - 0.06% (2)
privacy - 0.06% (2)
afriky - 0.06% (2)
registered - 0.06% (2)
report - 0.06% (2)
health - 0.06% (2)
fotbalového - 0.06% (2)
hackerspace - 0.06% (2)
filmy - 0.06% (2)
51.255.199.164 - 0.06% (2)
45.32.236.127 - 0.06% (2)
addresses - 0.06% (2)
tomu, - 0.06% (2)
104.238.188.38 - 0.06% (2)
zpravodajství - 0.06% (2)
přihlášení - 0.06% (2)
quite - 0.06% (2)
dny - 0.06% (2)
serveru - 0.06% (2)
seen - 0.06% (2)
provozu - 0.06% (2)
password - 0.06% (2)
before. - 0.06% (2)
attention - 0.06% (2)
session - 0.06% (2)
heslo - 0.06% (2)
nové - 0.06% (2)
probably - 0.06% (2)
přihlásit - 0.06% (2)
supporting - 0.06% (2)
infrastructure - 0.06% (2)
virové - 0.06% (2)
vytvořit - 0.06% (2)
these - 0.06% (2)
literatura - 0.06% (2)
criminals - 0.06% (2)
http://vps237553.ovh.net/polonia/guardar_numero.php - 0.06% (2)
http://vps237553.ovh.net/nexmo/ - 0.06% (2)
well - 0.06% (2)
company - 0.06% (2)
party - 0.06% (2)
what - 0.06% (2)
zajímavých - 0.06% (2)
bugs - 0.06% (2)
free - 0.06% (2)
exploits - 0.06% (2)
feed - 0.06% (2)
framework - 0.06% (2)
infosec - 0.06% (2)
institute - 0.06% (2)
discussed - 0.06% (2)
flow - 0.06% (2)
method - 0.06% (2)
writing - 0.06% (2)
target - 0.06% (2)
hodina - 0.06% (2)
[…] - 0.06% (2)
insidious - 0.06% (2)
služeb - 0.06% (2)
recently - 0.06% (2)
also - 0.06% (2)
- 0.06% (2)
victims - 0.06% (2)
document - 0.06% (2)
soldiers - 0.06% (2)
vaše - 0.06% (2)
příspěvky - 0.06% (2)
dupe - 0.06% (2)
francie - 0.06% (2)
accounts - 0.06% (2)
dormant - 0.06% (2)
novinky.cz - 0.06% (2)
vulnerable - 0.06% (2)
check - 0.06% (2)
almost - 0.06% (2)
virtual - 0.06% (2)
ever, - 0.06% (2)
said - 0.06% (2)
located - 0.06% (2)
comments - 0.06% (2)
apps, - 0.06% (2)
released - 0.06% (2)
patching - 0.06% (2)
after - 0.06% (2)
50,000 - 0.06% (2)
patched - 0.06% (2)
twitter - 0.06% (2)
privileges - 0.06% (2)
social - 0.06% (2)
anyone - 0.06% (2)
june - 0.06% (2)
2016, - 0.06% (2)
authentication - 0.06% (2)
stejné - 0.06% (2)
developed - 0.06% (2)
hummingwhale, - 0.06% (2)
satan - 0.06% (2)
ransomware, - 0.06% (2)
campaign - 0.06% (2)
known - 0.06% (2)
voleb - 0.06% (2)
které - 0.06% (2)
third - 0.06% (2)
gets - 0.06% (2)
play. - 0.06% (2)
days - 0.06% (2)
later, - 0.06% (2)
subscription - 0.06% (2)
paying - 0.06% (2)
services. - 0.06% (2)
months - 0.06% (2)
mid - 0.06% (2)
september - 0.06% (2)
seems - 0.06% (2)
downloads - 0.06% (2)
tried - 0.06% (2)
that, - 0.06% (2)
air - 0.06% (2)
regarding - 0.06% (2)
particular - 0.06% (2)
logging - 0.06% (2)
code, - 0.06% (2)
2015-09-29 - 0.06% (2)
2015-11-14 - 0.06% (2)
string - 0.06% (2)
returns, - 0.06% (2)
referring - 0.06% (2)
lines - 0.06% (2)
way. - 0.06% (2)
developer - 0.06% (2)
native - 0.06% (2)
patches - 0.06% (2)
app, - 0.06% (2)
hackeři - 0.06% (2)
send - 0.06% (2)
websites - 0.06% (2)
half - 0.06% (2)
did - 0.06% (2)
monday - 0.06% (2)
hot - 0.06% (2)
sued - 0.06% (2)
kaspersky - 0.06% (2)
result - 0.06% (2)
between - 0.06% (2)
companies - 0.06% (2)
tacyt - 0.06% (2)
mobile - 0.06% (2)
trying - 0.06% (2)
messages - 0.06% (2)
least - 0.06% (2)
high - 0.06% (2)
spain, - 0.06% (2)
servers, - 0.06% (2)
course, - 0.06% (2)
interesting - 0.06% (2)
certain - 0.06% (2)
groups - 0.06% (2)
detection - 0.06% (2)
mechanisms - 0.06% (2)
ago - 0.06% (2)
persists - 0.06% (2)
attacker - 0.06% (2)
focus - 0.06% (2)
relaunches - 0.06% (2)
hacking & - 0.64% (20)
& security - 0.64% (20)
kategorie: hacking - 0.64% (20)
google play - 0.58% (18)
min zpět - 0.55% (17)
of the - 0.45% (14)
in the - 0.45% (14)
such as - 0.19% (6)
threatpost - - 0.19% (6)
to the - 0.19% (6)
the app - 0.19% (6)
has been - 0.19% (6)
2 million - 0.16% (5)
one of - 0.16% (5)
big brother - 0.16% (5)
on the - 0.16% (5)
the same - 0.16% (5)
zpět a - 0.16% (5)
to upload - 0.16% (5)
the hacker - 0.13% (4)
from the - 0.13% (4)
in spain - 0.13% (4)
& security, - 0.13% (4)
40 min - 0.13% (4)
at the - 0.13% (4)
any video - 0.13% (4)
we found - 0.13% (4)
since the - 0.13% (4)
more than - 0.13% (4)
bezpečnostní systémy - 0.13% (4)
viry a - 0.13% (4)
hacker news - 0.13% (4)
security, viry - 0.13% (4)
a červi - 0.13% (4)
delete any - 0.13% (4)
news - - 0.13% (4)
we have - 0.13% (4)
or the - 0.13% (4)
systémy aut - 0.13% (4)
to google - 0.13% (4)
upload a - 0.13% (4)
google play, - 0.13% (4)
this app - 0.13% (4)
sledování i - 0.1% (3)
aut pro - 0.1% (3)
- bezpečnost - 0.1% (3)
auto vás - 0.1% (3)
naked security - 0.1% (3)
může šmírovat! - 0.1% (3)
could allow - 0.1% (3)
for the - 0.1% (3)
hodin 40 - 0.1% (3)
to use - 0.1% (3)
by the - 0.1% (3)
those applications - 0.1% (3)
used in - 0.1% (3)
phishing attacks - 0.1% (3)
gmail phishing - 0.1% (3)
bezpečnost - - 0.1% (3)
in spanish - 0.1% (3)
it was - 0.1% (3)
6 dnů - 0.1% (3)
the past - 0.1% (3)
found a - 0.1% (3)
spanish group - 0.1% (3)
should be - 0.1% (3)
fbi využívá - 0.1% (3)
to delete - 0.1% (3)
we can - 0.1% (3)
video on - 0.1% (3)
vás může - 0.1% (3)
šmírovat! fbi - 0.1% (3)
využívá bezpečnostní - 0.1% (3)
pro sledování - 0.1% (3)
i odposlech - 0.1% (3)
kind of - 0.1% (3)
have been - 0.1% (3)
the malware - 0.1% (3)
the security - 0.1% (3)
2017 - - 0.1% (3)
on facebook - 0.1% (3)
of app - 0.1% (3)
this kind - 0.1% (3)
leden, 2017 - 0.1% (3)
4 hodiny - 0.1% (3)
200,000 servers - 0.1% (3)
in google - 0.1% (3)
fotbalového mistrovství - 0.06% (2)
2015-09-29 to - 0.06% (2)
is used - 0.06% (2)
of android - 0.06% (2)
to 2015-11-14 - 0.06% (2)
past few - 0.06% (2)
group that - 0.06% (2)
from 2015-09-29 - 0.06% (2)
in such - 0.06% (2)
code for - 0.06% (2)
this was - 0.06% (2)
týdnů 6 - 0.06% (2)
this group - 0.06% (2)
applications that - 0.06% (2)
play for - 0.06% (2)
from google - 0.06% (2)
another android - 0.06% (2)
banking malware - 0.06% (2)
app in - 0.06% (2)
of course, - 0.06% (2)
have the - 0.06% (2)
tomu, že - 0.06% (2)
outside google - 0.06% (2)
be using - 0.06% (2)
přihlásit pomocí - 0.06% (2)
referring to - 0.06% (2)
health report - 0.06% (2)
first internet - 0.06% (2)
of them - 0.06% (2)
legitimate service - 0.06% (2)
references to - 0.06% (2)
can see - 0.06% (2)
order to - 0.06% (2)
as you - 0.06% (2)
22 leden, - 0.06% (2)
of apps - 0.06% (2)
that those - 0.06% (2)
internet health - 0.06% (2)
used from - 0.06% (2)
security of - 0.06% (2)
been quite - 0.06% (2)
supporting infrastructure - 0.06% (2)
was not - 0.06% (2)
to find - 0.06% (2)
on their - 0.06% (2)
similar to - 0.06% (2)
find it - 0.06% (2)
we could - 0.06% (2)
that they - 0.06% (2)
that was - 0.06% (2)
security session - 0.06% (2)
which is - 0.06% (2)
apps that - 0.06% (2)
gets >2 - 0.06% (2)
million downloads - 0.06% (2)
on google - 0.06% (2)
1 hodina - 0.06% (2)
10 million - 0.06% (2)
android devices - 0.06% (2)
as many - 0.06% (2)
virulent android - 0.06% (2)
as the - 0.06% (2)
malware has - 0.06% (2)
family of - 0.06% (2)
play apps - 0.06% (2)
researchers from - 0.06% (2)
techniques that - 0.06% (2)
patches critical - 0.06% (2)
malware returns, - 0.06% (2)
it news - 0.06% (2)
after the - 0.06% (2)
downloads on - 0.06% (2)
virové zpravodajství - 0.06% (2)
hacking filmy - 0.06% (2)
mapa webu - 0.06% (2)
oblíbený obsah - 0.06% (2)
android malware - 0.06% (2)
returns, gets - 0.06% (2)
>2 million - 0.06% (2)
apple patches - 0.06% (2)
hackers to - 0.06% (2)
critical kernel - 0.06% (2)
email service - 0.06% (2)
lavabit relaunches - 0.06% (2)
heartbleed persists - 0.06% (2)
on 200,000 - 0.06% (2)
servers, devices - 0.06% (2)
this bug - 0.06% (2)
kernel vulnerabilities - 0.06% (2)
under a - 0.06% (2)
uploaded a - 0.06% (2)
many as - 0.06% (2)
a výstavy - 0.06% (2)
[…] kategorie: - 0.06% (2)
novinky.cz - - 0.06% (2)
still vulnerable - 0.06% (2)
to heartbleed - 0.06% (2)
12 hodin - 0.06% (2)
and much - 0.06% (2)
resources - - 0.06% (2)
13 hodin - 0.06% (2)
fraudulent apps - 0.06% (2)
trying to - 0.06% (2)
not something - 0.06% (2)
easy to - 0.06% (2)
used by - 0.06% (2)
at least - 0.06% (2)
9 hodin - 0.06% (2)
infosec institute - 0.06% (2)
are still - 0.06% (2)
twitter botnet - 0.06% (2)
vulnerable to - 0.06% (2)
bug could - 0.06% (2)
allow hackers - 0.06% (2)
security researcher - 0.06% (2)
the social - 0.06% (2)
shared by - 0.06% (2)
the flaw - 0.06% (2)
dormant since - 0.06% (2)
insidious gmail - 0.06% (2)
have found - 0.06% (2)
that has - 0.06% (2)
institute resources - 0.06% (2)
discussed the - 0.06% (2)
control the - 0.06% (2)
the application - 0.06% (2)
xposed framework - 0.06% (2)
články projekty - 0.06% (2)
kategorie: hacking & - 0.64% (20)
hacking & security - 0.64% (20)
& security, viry - 0.13% (4)
viry a červi - 0.13% (4)
the hacker news - 0.13% (4)
40 min zpět - 0.13% (4)
to google play - 0.13% (4)
security, viry a - 0.13% (4)
delete any video - 0.13% (4)
hacking & security, - 0.13% (4)
hacker news - - 0.13% (4)
aut pro sledování - 0.1% (3)
využívá bezpečnostní systémy - 0.1% (3)
může šmírovat! fbi - 0.1% (3)
- 4 hodiny - 0.1% (3)
leden, 2017 - - 0.1% (3)
video on facebook - 0.1% (3)
to delete any - 0.1% (3)
naked security - - 0.1% (3)
hodin 40 min - 0.1% (3)
in the past - 0.1% (3)
this kind of - 0.1% (3)
- bezpečnost - - 0.1% (3)
sledování i odposlech - 0.1% (3)
systémy aut pro - 0.1% (3)
fbi využívá bezpečnostní - 0.1% (3)
vás může šmírovat! - 0.1% (3)
we can see - 0.06% (2)
find it in - 0.06% (2)
as we can - 0.06% (2)
outside google play - 0.06% (2)
from 2015-09-29 to - 0.06% (2)
in order to - 0.06% (2)
a výstavy virové - 0.06% (2)
very similar to - 0.06% (2)
able to upload - 0.06% (2)
been quite successful - 0.06% (2)
kind of apps - 0.06% (2)
in google play, - 0.06% (2)
source code for - 0.06% (2)
another android banking - 0.06% (2)
malware has been - 0.06% (2)
- 22 leden, - 0.06% (2)
22 leden, 2017 - 0.06% (2)
internet health report - 0.06% (2)
google play for - 0.06% (2)
infosec institute resources - 0.06% (2)
have found a - 0.06% (2)
on google play - 0.06% (2)
virulent android malware - 0.06% (2)
returns, gets >2 - 0.06% (2)
million downloads on - 0.06% (2)
patches critical kernel - 0.06% (2)
service lavabit relaunches - 0.06% (2)
heartbleed persists on - 0.06% (2)
200,000 servers, devices - 0.06% (2)
this bug could - 0.06% (2)
allow hackers to - 0.06% (2)
malware returns, gets - 0.06% (2)
>2 million downloads - 0.06% (2)
play apps that - 0.06% (2)
the past few - 0.06% (2)
secure email service - 0.06% (2)
on 200,000 servers, - 0.06% (2)
still vulnerable to - 0.06% (2)
could allow hackers - 0.06% (2)
that has been - 0.06% (2)
zpravodajství hacking filmy - 0.06% (2)
- 9 hodin - 0.06% (2)
insidious gmail phishing - 0.06% (2)
resources - 9 - 0.06% (2)
gmail phishing attacks - 0.06% (2)
are still vulnerable - 0.06% (2)
přihlásit pomocí openid - 0.06% (2)

Here you can find chart of all your popular one, two and three word phrases. Google and others search engines means your page is about words you use frequently.

Copyright © 2015-2016 hupso.pl. All rights reserved. FB | +G | Twitter

Hupso.pl jest serwisem internetowym, w którym jednym kliknieciem możesz szybko i łatwo sprawdź stronę www pod kątem SEO. Oferujemy darmowe pozycjonowanie stron internetowych oraz wycena domen i stron internetowych. Prowadzimy ranking polskich stron internetowych oraz ranking stron alexa.