4.76 score from hupso.pl for:
security-portal.cz



HTML Content


Titlesecurity-portal.cz | bezpečnost • hacking • komunita

Length: 52, Words: 6
Description pusty

Length: 0, Words: 0
Keywords pusty
Robots
Charset UTF-8
Og Meta - Title pusty
Og Meta - Description pusty
Og Meta - Site name pusty
Tytuł powinien zawierać pomiędzy 10 a 70 znaków (ze spacjami), a mniej niż 12 słów w długości.
Meta opis powinien zawierać pomiędzy 50 a 160 znaków (łącznie ze spacjami), a mniej niż 24 słów w długości.
Kodowanie znaków powinny być określone , UTF-8 jest chyba najlepszy zestaw znaków, aby przejść z powodu UTF-8 jest bardziej międzynarodowy kodowaniem.
Otwarte obiekty wykresu powinny być obecne w stronie internetowej (więcej informacji na temat protokołu OpenGraph: http://ogp.me/)

SEO Content

Words/Characters 9503
Text/HTML 47.62 %
Headings H1 1
H2 20
H3 20
H4 0
H5 0
H6 0
H1
kategorie
H2


menu
dnešní oblíbený obsah
aktuality
nejnovější příspěvky blogu

navigace
náhodný obsah
tagy
rss feed
přihlášení
poslední komentáře
konference
doporučujeme
gnu/linux & bsd
it news
security vulnerabilities & exploits

H3
insecure apps that open ports leave millions of smartphones at risk of hacking
wikileaks reveals cia tool ‘scribbles’ for document tracking
source code for cia’s tool to track whistleblowers leaked by wikileaks
news in brief: kashmir blocks social media; ‘whaling’ victims revealed; talktalk gdpr fine ‘would be £59m’
exploiting .net managed dcom
facebook admits it is being used as propaganda tool by ‘malicious actors’
opilý muž v silicon valley napadl bezpečnostního robota, vyvázl jen s odřeninami
threatpost news wrap, april 28, 2017
feedsportal.com - this domain may be for sale!
feedsportal.com - this domain may be for sale!
lawmaker calls on isps to stop customers being hit by viruses
secure shipping of physical data carriers to and from a cloud service provider
sports fans protest at plans to scan their faces as they head for the match
fcc: net neutrality is ‘politically motivated government overreach’
use of dns tunneling for c&c communications
google tightens noose on http: chrome to stick 'not secure' on pages with search fields
pemcracker - tool for cracking pem files
new macos malware, signed with legit apple id, found spying on https traffic
the security weaknesses of smartphones
sonarqube: a hidden gem
H4
H5
H6
strong
security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech.
b
security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech.
i
security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech.
em security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech.
Bolds strong 1
b 1
i 1
em 1
Zawartość strony internetowej powinno zawierać więcej niż 250 słów, z stopa tekst / kod jest wyższy niż 20%.
Pozycji używać znaczników (h1, h2, h3, ...), aby określić temat sekcji lub ustępów na stronie, ale zwykle, użyj mniej niż 6 dla każdego tagu pozycje zachować swoją stronę zwięzły.
Styl używać silnych i kursywy znaczniki podkreślić swoje słowa kluczowe swojej stronie, ale nie nadużywać (mniej niż 16 silnych tagi i 16 znaczników kursywy)

Statystyki strony

twitter:title pusty
twitter:description pusty
google+ itemprop=name pusty
Pliki zewnętrzne 8
Pliki CSS 2
Pliki javascript 6
Plik należy zmniejszyć całkowite odwołanie plików (CSS + JavaScript) do 7-8 maksymalnie.

Linki wewnętrzne i zewnętrzne

Linki 318
Linki wewnętrzne 158
Linki zewnętrzne 160
Linki bez atrybutu Title 224
Linki z atrybutem NOFOLLOW 0
Linki - Użyj atrybutu tytuł dla każdego łącza. Nofollow link jest link, który nie pozwala wyszukiwarkom boty zrealizują są odnośniki no follow. Należy zwracać uwagę na ich użytkowania

Linki wewnętrzne

- /
home /
články /node
projekty /page/projekty
hackerspace v čr /page/hackerspace-laby-v-%c4%8desk%c3%a9-republice
služby /page/slu%c5%beby-security-portalcz
security-portal.cz trička /clanky/tri%c4%8dka-security-portalcz
wallpapery /category/galerie/wallpapery
konference a výstavy /page/konference-v%c3%bdstavy
virové zpravodajství /page/virov%c3%a9-zpravodajstv%c3%ad
hacking filmy /page/hacking-filmy
literatura /page/literatura-e-learning
filozofie serveru /page/filozofie-serveru-security-portalcz
přidejte se k nám! /page/p%c5%99idejte-se-k-n%c3%a1m
podpořte nás! /page/podpo%c5%99te-n%c3%a1s
rady pro psaní /filter/tips
autoři serveru /page/auto%c5%99i-serveru
mapa webu /sitemap
kontakt & irc /page/kontaktn%c3%ad-informace
analýza cíleného útoku, část první /clanky/anal%c3%bdza-c%c3%adlen%c3%a9ho-%c3%batoku-%c4%8d%c3%a1st-prvn%c3%ad
rozdělování ip sítí /clanky/rozd%c4%9blov%c3%a1n%c3%ad-ip-s%c3%adt%c3%ad
tor (the onion router) - systém pro vysoce anonymní a šifrovaný přístup k internetu /clanky/tor-onion-router-syst%c3%a9m-pro-vysoce-anonymn%c3%ad-%c5%a1ifrovan%c3%bd-p%c5%99%c3%adstup-k-internetu
uk: ztracené peníze z vašeho bankovního účtu? no, je to vaše vina /node/3759
virové zpravodajství /page/virov%c3%a9-zpravodajstv%c3%ad
google hacking... (profesionalne) /clanky/google-hacking-profesionalne
další /popular/today
další /aggregator/categories/1
zákon gdpr, zavedený evropskou unií, bude mít dopad na každého z nás /node/3765
upřímní rapeři byli zatčeni za carding /node/3762
anonymous odcizili osobní údaje 5400 španělských policistů /node/3761
cena uniklých dat: linkedin, thumblr, myspace /node/3760
uk: ztracené peníze z vašeho bankovního účtu? no, je to vaše vina /node/3759
další /rss-blog.xml
- javascript:dogtranslate('cs|cs')
- javascript:dogtranslate('cs|en')
- javascript:dogtranslate('cs|fr')
- javascript:dogtranslate('cs|de')
- javascript:dogtranslate('cs|it')
- javascript:dogtranslate('cs|ru')
- javascript:dogtranslate('cs|es')
blogy /blog
obrázky /image
poslední příspěvky /tracker
oblíbený obsah /popular
agregátor rss /aggregator
kategorie /aggregator/categories
aktuality /aggregator/categories/10
transhumanismus /aggregator/categories/11
zdroje /aggregator/sources
mapa webu /sitemap
pokročilé (vy)užívání googlu část 1 /clanky/pokro%c4%8dil%c3%a9-vyu%c5%be%c3%adv%c3%a1n%c3%ad-googlu-%c4%8d%c3%a1st-1
internet explorer multiple remote code execution vulnerabilities /blog/internet-explorer-multiple-remote-code-execution-vulnerabilities
seznamte se – morfismy (oligomorfismus, polymorfismus, metamorfismus) /clanky/seznamte-se-%e2%80%93-morfismy-oligomorfismus-polymorfismus-metamorfismus
"kopírování cizích webů není zločin" rozhodl soud /clanky/kop%c3%adrov%c3%a1n%c3%ad-ciz%c3%adch-web%c5%af-nen%c3%ad-zlo%c4%8d-rozhodl-soud
jak to se mnou vypada? /blog/jak-se-mnou-vypada
igigi - novodobý hrdina nebo bad boy? /blog/igigi-novodob%c3%bd-hrdina-nebo-bad-boy
japonsko utrpělo masivní výběr z bankomatu: odcizeno 1,4 miliard jenů /node/3755
další /popular/all
security /category/tagy/security
hacking /category/tagy/hacking
konference /category/tagy/konference
programming /category/tagy/programming
sp news /category/tagy/sp-news
networks & protocols /category/tagy/networks-protocols
tisková zpráva /category/tagy/tiskov%c3%a1-zpr%c3%a1va
gnu/linux a bsd /category/tagy/gnu/linux-bsd
hacking method /category/tagy/hacking-method
anonymita /category/tagy/anonymita
exploit /category/tagy/exploit
cracking /category/tagy/cracking
více tagů /tagadelic/chunk/2
security-portal.cz - /rss.xml
sp - aktuality - /aggregator/rss/10
sp - usr blogy - /rss-blog.xml
blogy - /aggregator/rss/7
gnu/linux - /aggregator/rss/2
it news - /aggregator/rss/3
hacking - /aggregator/rss/1
exploits - /aggregator/rss/4
the hacker news /aggregator/sources/73
hacking & security /aggregator/categories/1
threatpost /aggregator/sources/80
hacking & security /aggregator/categories/1
the hacker news /aggregator/sources/73
hacking & security /aggregator/categories/1
sophos naked security /aggregator/sources/72
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
project zero /aggregator/sources/84
hacking & security /aggregator/categories/1
sophos naked security /aggregator/sources/72
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
zive.cz - bezpečnost /aggregator/sources/76
hacking & security /aggregator/categories/1
threatpost /aggregator/sources/80
hacking & security /aggregator/categories/1
the h security /aggregator/sources/68
hacking & security /aggregator/categories/1
securityworld.cz /aggregator/sources/11
hacking & security /aggregator/categories/1
sophos naked security /aggregator/sources/72
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
infosec institute resources /aggregator/sources/65
hacking & security /aggregator/categories/1
sophos naked security /aggregator/sources/72
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
sophos naked security /aggregator/sources/72
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
kaspersky securelist /aggregator/sources/71
hacking & security /aggregator/categories/1
viry a červi /aggregator/categories/9
linuxsecurity.com /aggregator/sources/70
hacking & security /aggregator/categories/1
linuxsecurity.com /aggregator/sources/70
hacking & security /aggregator/categories/1
the hacker news /aggregator/sources/73
hacking & security /aggregator/categories/1
infosec institute resources /aggregator/sources/65
hacking & security /aggregator/categories/1
infosec institute resources /aggregator/sources/65
hacking & security /aggregator/categories/1
2 /aggregator/categories/1?page=1
3 /aggregator/categories/1?page=2
4 /aggregator/categories/1?page=3
5 /aggregator/categories/1?page=4
6 /aggregator/categories/1?page=5
7 /aggregator/categories/1?page=6
8 /aggregator/categories/1?page=7
9 /aggregator/categories/1?page=8
následující › /aggregator/categories/1?page=1
poslední » /aggregator/categories/1?page=40
- /aggregator/rss/1
přihlásit pomocí openid /%2523
zrušit openid přihlášení /%2523
vytvořit nový účet /user/register
zaslat nové heslo /user/password
super /clanky/google-hacking-profesionalne#comment-596
:) o tobě psal /blog/definice-%c4%8desk%c3%a9ho-internetu-haters-haters-zase-haters#comment-595
umím zjistit skrytá čísla /clanky/lokalizace-t-mobile-sim-karet#comment-594
youtube /node/3752#comment-593
2 stejné ip adresy /clanky/rozd%c4%9blov%c3%a1n%c3%ad-ip-s%c3%adt%c3%ad#comment-592
další /comments/recent
další /aggregator/categories/2
další /aggregator/categories/3
další /aggregator/categories/4
home /
články /node
projekty /page/projekty
služby /page/slu%c5%beby-security-portalcz
konference a výstavy /page/konference-v%c3%bdstavy
virové zpravodajství /page/virov%c3%a9-zpravodajstv%c3%ad
hacking filmy /page/hacking-filmy
literatura /page/literatura-e-learning
- rss.xml

Linki zewnętrzne

- https://www.facebook.com/bezpecnost.hacking.komunita
- https://twitter.com/securitycz
securix gnu/linux https://www.securix.org
postřehy z bezpečnosti http://www.root.cz/serialy/postrehy-z-bezpecnosti/#ic=serial-box&icc=title
security session konference https://www.security-session.cz/
můj soused hacker http://sousede.security-portal.cz/
cz & sk tor community http://tor.security-portal.cz/
anon / ip checker http://anoncheck.security-portal.cz/
network tools http://network-tools.security-portal.cz/
convertor http://convertor.security-portal.cz/
sp pastebin http://paste.security-portal.cz
insecure apps that open ports leave millions of smartphones at risk of hacking http://thehackernews.com/2017/04/mobile-open-port-hacking.html
wikileaks reveals cia tool ‘scribbles’ for document tracking http://threatpost.com/wikileaks-reveals-cia-tool-scribbles-for-document-tracking/125299/
source code for cia’s tool to track whistleblowers leaked by wikileaks http://thehackernews.com/2017/04/wikileaks-scribbles-cia-whistleblower.html
news in brief: kashmir blocks social media; ‘whaling’ victims revealed; talktalk gdpr fine ‘would be £59m’ http://feedproxy.google.com/~r/nakedsecurity/~3/fqgfewf9ue8/
exploiting .net managed dcom http://googleprojectzero.blogspot.com/2017/04/exploiting-net-managed-dcom.html
facebook admits it is being used as propaganda tool by ‘malicious actors’ http://feedproxy.google.com/~r/nakedsecurity/~3/zu3fgzrtoby/
fórum security-portal.cz - http://forum.security-portal.cz/rss.php?mode=posts
insecure apps that open ports leave millions of smartphones at risk of hacking http://thehackernews.com/2017/04/mobile-open-port-hacking.html
http://feeds.feedburner.com/~ff/thehackernews_com?a=bfcjl8yyadg:1dhav7f6tug:yil2auoc8za
http://feeds.feedburner.com/~ff/thehackernews_com?a=bfcjl8yyadg:1dhav7f6tug:qj6idk7rits
http://feeds.feedburner.com/~ff/thehackernews_com?a=bfcjl8yyadg:1dhav7f6tug:gin9vfwoqvq
http://feeds.feedburner.com/~ff/thehackernews_com?a=bfcjl8yyadg:1dhav7f6tug:v_sglipbpwu
http://feeds.feedburner.com/~ff/thehackernews_com?a=bfcjl8yyadg:1dhav7f6tug:f7zbnmyn0lo
wikileaks reveals cia tool ‘scribbles’ for document tracking http://threatpost.com/wikileaks-reveals-cia-tool-scribbles-for-document-tracking/125299/
source code for cia’s tool to track whistleblowers leaked by wikileaks http://thehackernews.com/2017/04/wikileaks-scribbles-cia-whistleblower.html
http://feeds.feedburner.com/~ff/thehackernews_com?a=nuyxngci0_e:zrenzs2dy3c:yil2auoc8za
http://feeds.feedburner.com/~ff/thehackernews_com?a=nuyxngci0_e:zrenzs2dy3c:qj6idk7rits
http://feeds.feedburner.com/~ff/thehackernews_com?a=nuyxngci0_e:zrenzs2dy3c:gin9vfwoqvq
http://feeds.feedburner.com/~ff/thehackernews_com?a=nuyxngci0_e:zrenzs2dy3c:v_sglipbpwu
http://feeds.feedburner.com/~ff/thehackernews_com?a=nuyxngci0_e:zrenzs2dy3c:f7zbnmyn0lo
news in brief: kashmir blocks social media; ‘whaling’ victims revealed; talktalk gdpr fine ‘would be £59m’ http://feedproxy.google.com/~r/nakedsecurity/~3/fqgfewf9ue8/
exploiting .net managed dcom http://googleprojectzero.blogspot.com/2017/04/exploiting-net-managed-dcom.html
this short video https://channel9.msdn.com/blogs/thechannel9team/anders-hejlsberg-what-brought-about-the-birth-of-the-clr
com callable wrapper https://msdn.microsoft.com/en-us/library/f07c8z1c(v=vs.110).aspx
clickonce deployment https://msdn.microsoft.com/en-us/library/t71a733d(v=vs.80).aspx
cve-2014-0257 http://www.cve.mitre.org/cgi-bin/cvename.cgi?name=cve-2014-0257
.net reflection apis https://msdn.microsoft.com/en-us/library/f7ykdhsy(v=vs.110).aspx
process.start https://msdn.microsoft.com/en-us/library/h6ak8zt5(v=vs.110).aspx
github https://github.com/tyranid/ie11sandboxescapes/blob/master/cve-2014-0257/cve-2014-0257.cpp
runtime callable wrapper https://msdn.microsoft.com/en-us/library/8bwh56xe(v=vs.110).aspx
application domain https://msdn.microsoft.com/en-us/library/2bh4z9hs(v=vs.110).aspx
imanagedobject https://msdn.microsoft.com/en-us/library/cc233673.aspx
documented https://msdn.microsoft.com/en-us/library/cc233722.aspx
binaryformatter::serialize https://msdn.microsoft.com/en-us/library/c5sbs8z9(v=vs.110).aspx
binaryformatter::deserialize https://msdn.microsoft.com/en-us/library/b85344hz(v=vs.110).aspx
java https://www.slideshare.net/codewhitesec/java-deserialization-vulnerabilities-the-forgotten-bug-class
php https://www.owasp.org/index.php/php_object_injection
ruby https://www.rapid7.com/db/modules/exploit/multi/http/rails_xml_yaml_code_exec
presentation https://www.youtube.com/watch?v=xfbu-pq1tic
whitepaper https://www.contextis.com/documents/1/are_you_my_type.pdf
this blog post https://blog.scrt.ch/2016/05/12/net-serialiception/
cve-2014-4073 http://www.cve.mitre.org/cgi-bin/cvename.cgi?name=cve-2014-4073
hashtable https://msdn.microsoft.com/en-us/library/system.collections.hashtable(v=vs.110).aspx
ihashcodeprovider https://msdn.microsoft.com/en-us/library/system.collections.ihashcodeprovider(v=vs.110).aspx
ihashcodeprovider::gethashcode https://msdn.microsoft.com/en-us/library/system.collections.ihashcodeprovider.gethashcode(v=vs.110).aspx
delegate https://msdn.microsoft.com/en-us/library/system.delegate(v=vs.110).aspx
find on github https://github.com/tyranid/exploitdotnetdcom/tree/master/exploitdotnetdcomserializer
dangers of .net dcom https://blogs.technet.microsoft.com/srd/2014/10/14/more-details-about-cve-2014-4073-elevation-of-privilege-vulnerability/
here https://bugs.chromium.org/p/project-zero/issues/detail?id=1075
system.management https://msdn.microsoft.com/en-us/library/system.management(v=vs.110).aspx
get-wmiobject https://technet.microsoft.com/en-us/library/ee176860.aspx
get-ciminstance https://technet.microsoft.com/en-us/itpro/powershell/windows/cimcmdlets/get-ciminstance
ms-wmi https://msdn.microsoft.com/en-us/library/dd208060.aspx
iwbemlevel1login::ntlmlogin https://msdn.microsoft.com/en-us/library/cc250759.aspx
gacutil utility https://msdn.microsoft.com/en-us/library/ex0ss12c%28v=vs.110%29.aspx
reference source https://github.com/microsoft/referencesource/blob/90b323fe52bec428fe4bd5f007e9ead6b265d553/mscorlib/system/collections/generic/comparer.cs#l157
icomparer<t> https://msdn.microsoft.com/en-us/library/8ehhxeaf%28v=vs.110%29.aspx
comparer<t>::create https://msdn.microsoft.com/en-us/library/hh737198%28v=vs.110%29.aspx
icomparer<t>::compare https://msdn.microsoft.com/en-us/library/bb346115%28v=vs.110%29.aspx
sortedset<t> https://msdn.microsoft.com/en-us/library/dd412070(v=vs.110).aspx
system.workflow.componentmodel.serialization https://msdn.microsoft.com/en-us/library/system.workflow.componentmodel.serialization(v=vs.110).aspx
windows workflow foundation https://msdn.microsoft.com/en-us/library/jj684582.aspx
code integrity in windows powershell http://www.exploit-monday.com/2013/07/winrt-arm-shellcode.html?showcomment=1376669197806#c4072135924776553338
objectserializedref https://github.com/microsoft/referencesource/blob/4fe4349175f4c5091d972a7e56ea12012f1e7170/system.workflow.componentmodel/authoringom/serializer/activitysurrogateselector.cs#l135
activitiysurrogateselector https://msdn.microsoft.com/en-us/library/system.workflow.componentmodel.serialization.activitysurrogateselector%28v=vs.110%29.aspx
system.linq.enumerable https://msdn.microsoft.com/en-us/library/system.linq.enumerable(v=vs.110).aspx
enumerable.join https://msdn.microsoft.com/en-us/library/system.linq.enumerable.join%28v=vs.110%29.aspx
enumerable.zip https://msdn.microsoft.com/en-us/library/dd267698%28v=vs.110%29.aspx
following code https://github.com/microsoft/referencesource/blob/4fe4349175f4c5091d972a7e56ea12012f1e7170/mscorlib/system/collections/hashtable.cs#l959
getresourcestring https://github.com/microsoft/referencesource/blob/4fe4349175f4c5091d972a7e56ea12012f1e7170/mscorlib/system/environment.cs#l1331
issue tracker https://bugs.chromium.org/p/project-zero/issues/detail?id=1081#c5
facebook admits it is being used as propaganda tool by ‘malicious actors’ http://feedproxy.google.com/~r/nakedsecurity/~3/zu3fgzrtoby/
opilý muž v silicon valley napadl bezpečnostního robota, vyvázl jen s odřeninami http://www.zive.cz/bleskovky/opily-muz-vsilicon-valley-napadl-bezpecnostniho-robota-vyvazl-jen-s-odreninami/sc-4-a-187416/default.aspx?utm_medium=selfpromo&utm_source=zive&utm_campaign=rssfeed
threatpost news wrap, april 28, 2017 http://threatpost.com/threatpost-news-wrap-april-21-2017-2/125286/
feedsportal.com - this domain may be for sale! http://avledn.in/rss?dn=feedsportal.com
click here for more information http://avledn.in/rss?dn=feedsportal.com
feedsportal.com - this domain may be for sale! http://avledn.in/rss?dn=feedsportal.com
click here for more information http://avledn.in/rss?dn=feedsportal.com
lawmaker calls on isps to stop customers being hit by viruses http://feedproxy.google.com/~r/nakedsecurity/~3/03t-jgtxfaa/
secure shipping of physical data carriers to and from a cloud service provider http://resources.infosecinstitute.com/secure-shipping-physical-data-carriers-cloud-service-provider/
secure shipping of physical data carriers to and from a cloud service provider http://resources.infosecinstitute.com/secure-shipping-physical-data-carriers-cloud-service-provider/
infosec resources http://resources.infosecinstitute.com
sports fans protest at plans to scan their faces as they head for the match http://feedproxy.google.com/~r/nakedsecurity/~3/-uohmmy9vba/
fcc: net neutrality is ‘politically motivated government overreach’ http://feedproxy.google.com/~r/nakedsecurity/~3/wgh6aop5bhm/
use of dns tunneling for c&c communications https://securelist.com/blog/research/78203/use-of-dns-tunneling-for-cc-communications/
morris worm https://en.wikipedia.org/wiki/morris_worm
mirai https://securelist.com/blog/research/76954/is-mirai-really-as-black-as-its-being-painted/
https://securelist.com/files/2017/04/backdoor_dns_eng_1.png
https://securelist.com/files/2017/04/backdoor_dns_eng_2.png
https://securelist.com/files/2017/04/backdoor_dns_eng_3.png
https://securelist.com/files/2017/04/backdoor_dns_eng_4.png
https://securelist.com/files/2017/04/backdoor_dns_eng_5.png
https://securelist.com/files/2017/04/backdoor_dns_eng_6.png
https://securelist.com/files/2017/04/backdoor_dns_eng_7.png
https://securelist.com/files/2017/04/backdoor_dns_eng_8.png
https://securelist.com/files/2017/04/backdoor_dns_eng_9.png
https://securelist.com/files/2017/04/backdoor_dns_eng_10.png
plugx https://securelist.com/blog/research/66960/winnti-returns-with-plugx/
google tightens noose on http: chrome to stick 'not secure' on pages with search fields http://www.linuxsecurity.com/content/view/171338?rdf
pemcracker - tool for cracking pem files http://www.linuxsecurity.com/content/view/171337?rdf
new macos malware, signed with legit apple id, found spying on https traffic http://thehackernews.com/2017/04/apple-mac-malware.html
http://feeds.feedburner.com/~ff/thehackernews_com?a=mygzbfxaklq:sv12b6yqzvq:yil2auoc8za
http://feeds.feedburner.com/~ff/thehackernews_com?a=mygzbfxaklq:sv12b6yqzvq:qj6idk7rits
http://feeds.feedburner.com/~ff/thehackernews_com?a=mygzbfxaklq:sv12b6yqzvq:gin9vfwoqvq
http://feeds.feedburner.com/~ff/thehackernews_com?a=mygzbfxaklq:sv12b6yqzvq:v_sglipbpwu
http://feeds.feedburner.com/~ff/thehackernews_com?a=mygzbfxaklq:sv12b6yqzvq:f7zbnmyn0lo
the security weaknesses of smartphones http://resources.infosecinstitute.com/security-weaknesses-smartphones-2/
the security weaknesses of smartphones http://resources.infosecinstitute.com/security-weaknesses-smartphones-2/
infosec resources http://resources.infosecinstitute.com
sonarqube: a hidden gem http://resources.infosecinstitute.com/sonarqube-hidden-gem/
sonarqube: a hidden gem http://resources.infosecinstitute.com/sonarqube-hidden-gem/
infosec resources http://resources.infosecinstitute.com
co je openid? http://openid.net/
- http://www.stech.cz/konference/ict.aspx
- http://cryptofest.cz/?node=program
- http://www.security-session.cz
-
-
-
-
-
-
http://www.itsw.cz
- http://idc-czech.cz/cze/konference/56985-idc-cloud-computing-conference-2014/7-overview
- http://www.bezpecnostvcloudu.cz
- http://idc-cema.com/eng/events/56335-idc-it-security-roadshow-2014?g_clang=cze
- http://www.europen.cz
- http://www.planujakci.cz/
- http://brmlab.cz
http://www.ceskapiratskastrana.cz
- http://bflow.security-portal.cz/
- http://secit.sk/
http://www.blackhole.sk
- http://www.skodlivysoftware.cz/
http://www.viry.cz
- http://hack4fun.eu/
oss víkend bratislava, 17. - 18. jún 2017 – cfp http://www.abclinuxu.cz/zpravicky/oss-vikend-bratislava-17.-18.-jun-2017-cfp
state of the commons – creative commons 2016 http://www.abclinuxu.cz/zpravicky/state-of-the-commons-creative-commons-2016
postřehy z bezpečnosti: watsone, s cloudy je to nuda https://www.root.cz/clanky/postrehy-z-bezpecnosti-watsone-s-cloudy-je-to-nuda/?utm_source=rss&utm_medium=text&utm_campaign=rss
lakka 2.0 http://www.abclinuxu.cz/zpravicky/lakka-2.0
rekordní trest: 27 let za hackování a krádeže platebních karet [stalo se] https://www.root.cz/clanky/rekordni-trest-27-let-za-hackovani-a-kradeze-platebnich-karet/?utm_source=rss&utm_medium=text&utm_campaign=rss
hikey 960, superrychlý konkurent raspberry pi s čipem huawei kirin 960 http://diit.cz/clanek/hikey-960-superrychly-konkurent-raspberry-pi-s-cipem-huawei-kirin-960#utm_source=atom&utm_medium=feed&utm_content=article
nový computer: travel hacking, jak ochránit facebook a hromada testů http://www.zive.cz/clanky/novy-computer-travel-hacking-jak-ochranit-facebook-a-hromada-testu/sc-3-a-187408/default.aspx
týden živě: první američané dostanou chytrá auta googlu. iptv je budoucnost televize http://www.zive.cz/clanky/tyden-zive-prvni-americane-dostanou-chytra-auta-googlu-iptv-je-budoucnost-televize/sc-3-a-187418/default.aspx
proměnili jsme raspberry pi v chytrou hlasovou asistentku google home http://www.zive.cz/clanky/promenili-jsme-raspberry-pi-v-chytrou-hlasovou-asistentku-google-home/sc-3-a-187430/default.aspx
podívejte se na fúzní reaktor tokamak st40 http://vtm.zive.cz/bleskovky/podivejte-se-na-fuzni-reaktor-tokamak-st40/sc-871-a-187431/default.aspx
emby mediaserver 3.2.5 directory traversal file disclosure vulnerability http://www.exploitalert.com/view-details.html?id=26560
emby mediaserver 3.2.5 reflected xss vulnerability http://www.exploitalert.com/view-details.html?id=26561
emby mediaserver 3.2.5 password reset vulnerability http://www.exploitalert.com/view-details.html?id=26562
emby mediaserver 3.2.5 boolean-based blind sql injection vulnerability http://www.exploitalert.com/view-details.html?id=26563
apple ios 10.2 & 10.3 - control panel denial of service vulnerability *youtube http://www.exploitalert.com/view-details.html?id=26557
- http://creativecommons.org/licenses/by-sa/3.0/
creative commons attribution-share alike 3.0 unported license http://creativecommons.org/licenses/by-sa/3.0/
- http://drupal.org
dr. radut http://www.radut.net/

Zdjęcia

Zdjęcia 40
Zdjęcia bez atrybutu ALT 11
Zdjęcia bez atrybutu TITLE 36
Korzystanie Obraz ALT i TITLE atrybutu dla każdego obrazu.

Zdjęcia bez atrybutu TITLE

/sites/default/files/images/facebook-button.gif
/sites/default/files/images/twitter-sp.gif
/sites/default/files/salamander12-white_logo.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/modules/gtranslate/gtranslate-files/blank.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
/misc/feed.png
http://www.security-portal.cz/sites/default/files/securitysessionbanner.gif
http://www.expo-net.cz/foto/loga_nase/o-logo_itsw.jpg
/sites/default/files/idc-cc-120x60-cz.gif
http://www.bezpecnostvcloudu.cz/files/clanky/ikonka_bvc.gif
/sites/default/files/idc.gif
http://www.security-portal.cz/sites/default/files/europen.png
http://www.security-portal.cz/img/logo/planujakci/planujakci-cz-4.gif
http://www.security-portal.cz/img/logo/brmlab/brmlab.gif
http://www.ceskapiratskastrana.cz/media/grafika/cps_banner_88x31_whitebg.gif
http://bflow.security-portal.cz/banner/banner2.gif
http://www.security-portal.cz/img/logo/secit/secit.png
http://www.security-portal.cz/img/logo/blackhole/blackhole1.gif
http://www.skodlivysoftware.cz/images/banner.gif
http://www.security-portal.cz/img/logo/viry/viry_cz.gif
http://www.security-portal.cz/img/logo/hack4fun/hack4fun-banner1.jpg
http://i.creativecommons.org/l/by-sa/3.0/80x15.png
/misc/feed.png

Zdjęcia bez atrybutu ALT

/sites/default/files/images/facebook-button.gif
/sites/default/files/images/twitter-sp.gif
http://www.stech.cz/portals/0/konference/2015/06%20ict/90x60.gif
/sites/default/files/images/cryptofest.png
http://www.security-portal.cz/sites/default/files/securitysessionbanner.gif
http://www.expo-net.cz/foto/loga_nase/o-logo_itsw.jpg
http://www.bezpecnostvcloudu.cz/files/clanky/ikonka_bvc.gif
/sites/default/files/idc.gif
http://www.security-portal.cz/sites/default/files/europen.png
http://www.security-portal.cz/img/logo/planujakci/planujakci-cz-4.gif
http://bflow.security-portal.cz/banner/banner2.gif

Ranking:


Alexa Traffic
Daily Global Rank Trend
Daily Reach (Percent)









Majestic SEO











Text on page:

hledat na tomto webu: lidé litují, jak špatně využili času, který je už za nimi, ale to je nepřivede vždy k tomu, aby lépe využili času, který jim k životu zbývá. — jean de la bruyére menu home články projektysecurix gnu/linux postřehy z bezpečnosti security session konference hackerspace v čr můj soused hacker cz & sk tor community službyanon / ip checker network tools convertor security-portal.cz trička sp pastebin wallpapery konference a výstavy virové zpravodajství hacking filmy literatura filozofie serveru přidejte se k nám! podpořte nás! rady pro psaní autoři serveru mapa webu kontakt & irc dnešní oblíbený obsah analýza cíleného útoku, část první (120) rozdělování ip sítí (24) tor (the onion router) - systém pro vysoce anonymní a šifrovaný přístup k internetu (23) uk: ztracené peníze z vašeho bankovního účtu? no, je to vaše vina (20) virové zpravodajství (18) google hacking... (profesionalne) (18) další aktuality insecure apps that open ports leave millions of smartphones at risk of hacking wikileaks reveals cia tool ‘scribbles’ for document tracking source code for cia’s tool to track whistleblowers leaked by wikileaks news in brief: kashmir blocks social media; ‘whaling’ victims revealed; talktalk gdpr fine ‘would be £59m’ exploiting .net managed dcom facebook admits it is being used as propaganda tool by ‘malicious actors’ další nejnovější příspěvky blogu zákon gdpr, zavedený evropskou unií, bude mít dopad na každého z nás upřímní rapeři byli zatčeni za carding anonymous odcizili osobní údaje 5400 španělských policistů cena uniklých dat: linkedin, thumblr, myspace uk: ztracené peníze z vašeho bankovního účtu? no, je to vaše vina další select languageczechafrikaansalbanianarabicbelarusianbulgariancatalanchinese (simplified)chinese (traditional)croatiandanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish navigace blogy obrázky poslední příspěvky oblíbený obsah agregátor rsskategorieaktuality transhumanismus zdroje mapa webu náhodný obsah pokročilé (vy)užívání googlu část 1 (33,965) internet explorer multiple remote code execution vulnerabilities (11,281) seznamte se – morfismy (oligomorfismus, polymorfismus, metamorfismus) (11,600) "kopírování cizích webů není zločin" rozhodl soud (13,800) jak to se mnou vypada? (12,758) igigi - novodobý hrdina nebo bad boy? (27,884) japonsko utrpělo masivní výběr z bankomatu: odcizeno 1,4 miliard jenů (2,520) další tagy security hacking konference programming sp news networks & protocols tisková zpráva gnu/linux a bsd hacking method anonymita exploit cracking více tagů rss feed security-portal.cz sp - aktuality sp - usr blogy fórum security-portal.cz rss feed aggregator: blogy gnu/linux it news hacking exploits security-portal.cz je internetový portál zaměřený na počítačovou bezpečnost, hacking, anonymitu, počítačové sítě, programování, šifrování, exploity, linux a bsd systémy. provozuje spoustu zajímavých služeb a podporuje příznivce v zajímavých projektech. kategorie insecure apps that open ports leave millions of smartphones at risk of hacking the hacker news - 29 duben, 2017 - 13:25 a team of researchers from the university of michigan discovered that hundreds of applications in google play store have a security hole that could potentially allow hackers to steal data from and even implant malware on millions of android smartphones. the university of michigan team says that the actual issue lies within apps that create open ports — a known problem with computers — on kategorie: hacking & security wikileaks reveals cia tool ‘scribbles’ for document tracking threatpost - 29 duben, 2017 - 00:52 the cia is planting web beacons inside microsoft word documents to track whistleblowers, journalists and informants, according to wikileaks. kategorie: hacking & security source code for cia’s tool to track whistleblowers leaked by wikileaks the hacker news - 28 duben, 2017 - 20:34 wikileaks has just published a new batch of the vault 7 leak, exposing the documentation and source code for a cia project known as "scribbles." scribbles, a.k.a. the "snowden stopper," is a piece of software allegedly designed to embed 'web beacon' tags into confidential documents, allowing the spying agency to track whistleblowers and foreign spies. since march, as part of its "vault 7" kategorie: hacking & security news in brief: kashmir blocks social media; ‘whaling’ victims revealed; talktalk gdpr fine ‘would be £59m’ sophos naked security - 28 duben, 2017 - 19:31 your daily round-up of some of the other stories in the news kategorie: hacking & security, viry a červi exploiting .net managed dcom project zero - 28 duben, 2017 - 18:23 posted by james forshaw, project zero one of the more interesting classes of security vulnerabilities are those affecting interoperability technology. this is because these vulnerabilities typically affect any application using the technology, regardless of what the application actually does. also in many cases they’re difficult for a developer to mitigate outside of not using that technology, something which isn’t always possible. i discovered one such vulnerability class in the component object model (com) interoperability layers of .net which make the use of .net for distributed com (dcom) across privilege boundaries inherently insecure. this blog post will describe a couple of ways this could be abused, first to gain elevated privileges and then as a remote code execution vulnerability. a little bit of background knowledgeif you look at the history of .net many of its early underpinnings was trying to make a better version of com (for a quick history lesson it’s worth watching this short video of anders hejlsberg discussing .net). this led to microsoft placing a large focus on ensuring that while .net itself might not be com it must be able to interoperate with com. therefore .net can both be used to implement as well as consume com objects. for example instead of calling queryinterface on a com object you can just cast an object to a com compatible interface. implementing an out-of-process com server in c# is as simple as the following: // define com interface. [comvisible(true)] [interfacetype(cominterfacetype.interfaceisidispatch)] [guid("3d2392cb-2273-4a76-9c5d-b2c8a3120257")] public interface icustominterface { void dosomething(); } // define com class implementing interface. [comvisible(true)] [guid("8bc3f05e-d86b-11d0-a075-00c04fb68820")] public class comobject : icustominterface { public void dosomething() {} } // register com class with com services. registrationservices reg = new registrationservices(); int cookie = reg.registertypeforcomclients( typeof(comobject), registrationclasscontext.localserver | registrationclasscontext.remoteserver, registrationconnectiontype.multipleuse); a client can now connect to the com server using it’s clsid (defined by the guid attribute on comclass). this is in fact so simple to do that a large number of core classes in .net are marked as com visible and registered for use by any com client even those not written in .net. to make this all work the .net runtime hides a large amount of boilerplate from the developer. there are a couple of mechanisms to influence this boilerplate interoperability code, such as the interfacetype attribute which defines whether the com interface is derived from iunknown or idispatch but for the most part you get what you’re given. one thing developers perhaps don’t realize is that it’s not just the interfaces you specify which get exported from the .net com object but the runtime adds a number of “management” interfaces as well. this interfaces are implemented by wrapping the .net object inside a com callable wrapper (ccw). we can enumerate what interfaces are exposed by the ccw. taking system.object as an example the following table shows what interfaces are supported along with how each interface is implemented, either dynamically at runtime or statically implemented inside the runtime. interface nameimplementation type_objectdynamiciconnectionpointcontainerstaticidispatchdynamicimanagedobjectstaticimarshalstaticiprovideclassinfostaticisupporterrorinfostaticiunknowndynamic the _object interface refers to the com visible representation of the system.object class which is the root of all .net objects, it must be generated dynamically as it’s dependent on the .net object being exposed. on the other hand imanagedobject is implemented by the runtime itself and the implementation is shared across all ccws. i started looking at the exposed com attack surface for .net back in 2013 when i was investigating internet explorer sandbox escapes. one of the com objects you could access outside the sandbox was the .net clickonce deployment broker (dfsvc) which turned out to be implemented in .net, which is probably not too surprising. i actually found two issues, not in dfsvc itself but instead in the _object interface exposed by all .net com objects. the _object interface looks like the following (in c++). struct _object : public idispatch { hresult tostring(bstr * pretval); hresult equals(variant obj, variant_bool *pretval); hresult gethashcode(long *pretval); hresult gettype(_type** pretval); }; the first bug (which resulted in cve-2014-0257) was in the gettype method. this method returns a com object which can be used to access the .net reflection apis. as the returned _type com object was running inside the server you could call a chain of methods which resulted in getting access to the process.start method which you could call to escape the sandbox. if you want more details about that you can look at the poc i wrote and put up on github. microsoft fixed this by preventing the access to the reflection apis over dcom. the second issue was more subtle and is a byproduct of a feature of .net interop which presumably no-one realized would be a security liability. loading the .net runtime requires quite a lot of additional resources, therefore the default for a native com client calling methods on a .net com server is to let com and the ccw manage the communication, even if this is a performance hit. microsoft could have chosen to use the com marshaler to force .net to be loaded in the client but this seems overzealous, not even counting the possibility that the client might not even have a compatible version of .net installed. when .net interops with a com object it creates the inverse of the ccw, the runtime callable wrapper (rcw). this is a .net object which implements a runtime version of the com interface and marshals it to the com object. now it’s entirely possible that the com object is actually written in .net, it might even be in the same application domain. if .net didn’t do something you could end up with a double performance hit, marshaling in the rcw to call a com object which is actually a ccw to a managed object. it would be nice to try and “unwrap” the managed object from the ccw and get back a real .net object. this is where the villain in this piece comes into play, the imanagedobject interface, which looks like the following: struct imanagedobject : public iunknown { hresult getobjectidentity( bstr* pbstrguid, int* appdomainid, int* pccw); hresult getserializedbuffer( bstr *pbstr ); }; when the .net runtime gets hold of a com object it will go through a process to determine whether it can “unwrap” the object from its ccw and avoid creating an rcw. this process is documented but in summary the runtime will do the following: call queryinterface on the com object to determine if it implements the imanagedobject interface. if not then return an appropriate rcw.call getobjectidentity on the interface. if the guid matches the per-runtime guid (generated at runtime startup) and the appdomain id matches the current appdomain id then lookup the ccw value in a runtime table and extract a pointer to the real managed object and return it.call getserializedbuffer on the interface. the runtime will check if the .net object is serializable, if so it will pass the object to binaryformatter::serialize and package the result in a binary string (bstr). this will be returned to the client which will now attempt to deserialize the buffer to an object instance by calling binaryformatter::deserialize. both steps 2 and 3 sound like a bad idea. for example while in 2 the per-runtime guid can’t be guessed; if you have access to any other object in the same process (such as the com object exposed by the server itself) you can call getobjectidentity on the object and replay the guid and appdomain id back to the server. this doesn’t really gain you much though, the ccw value is just a number not a pointer so at best you’ll be able to extract objects which already have a ccw in place. instead it’s step 3 which is really nasty. arbitrary deserialization is dangerous almost no matter what language (take your pick, java, php, ruby etc.) and .net is no different. in fact my first ever blackhat usa presentation (whitepaper) was on this very topic and there’s been follow up work since (such as this blog post). clearly this is an issue we can exploit, first let’s look at it from the perspective of privilege escalation.elevating privilegeshow can we get a com server written in .net to do the arbitrary deserialization? we need the server to try and create an rcw for a serializable .net object exposed over com. it would be nice if this could also been done generically; it just so happens that on the standard _object interface there exists a function we can pass an arbitrary object to, the equals method. the purpose of equals is to compare two objects for equality. if we pass a .net com object to the server’s equals method the runtime must try and convert it to an rcw so that the managed implementation can use it. at this point the runtime wants to be helpful and checks if it’s really a ccw wrapped .net object. the server runtime calls getserializedbuffer which results in arbitrary deserialization in the server process. this is how i exploited the clickonce deployment broker a second time resulting in cve-2014-4073. the trick to exploiting this was to send a serialized hashtable to the server which contains a com implementation of the ihashcodeprovider interface. when the hashtable runs its custom deserialization code it needs to rebuild its internal hash structures, it does that by calling ihashcodeprovider::gethashcode on each key. by adding a delegate object, which is serializable, as one of the keys we’ll get it passed back to the client. by writing the client in native code the automatic serialization through imanagedobject won’t occur when passing the delegate back to us. the delegate object gets stuck inside the server process but the ccw is exposed to us which we can call. invoking the delegate results in the specified function being executed in the server context which allows us to start a new process with the server’s privileges. as this works generically i even wrote a tool to do it for any .net com server which you can find on github. microsoft could have fixed cve-2014-4073 by changing the behavior of imanagedobject::getserializedbuffer but they didn’t. instead microsoft rewrote the broker in native code instead. also a blog post was published warning developers of the dangers of .net dcom. however what they didn’t do is deprecate any of the apis to register dcom objects in .net so unless a developer is particularly security savvy and happens to read a microsoft security blog they probably don’t realize it’s a problem. this bug class exists to this day, for example when i recently received a new work laptop i did what i always do, enumerate what oem “value add” software has been installed and see if anything was exploitable. it turns out that as part of the audio driver package was installed a com service written by dolby. after a couple of minutes of inspection, basically enumerating accessible interface for the com server, i discovered it was written in .net (the presence of imanagedobject is always a big giveaway). i cracked out my exploitation tool and in less than 5 minutes i had code execution at local system. this has now been fixed as cve-2017-7293, you can find the very terse writeup here. once again as .net dcom is fundamentally unsafe the only thing dolby could do was rewrite the service in native code.hacking the callerfinding a new instance of the imanagedobject bug class focussed my mind on its other implications. the first thing to stress is the server itself isn’t vulnerable, instead it’s only when we can force the server to act as a dcom client calling back to the attacking application that the vulnerability can be exploited. any .net application which calls a dcom object through managed com interop should have a similar issue, not just servers. is there likely to be any common use case for dcom, especially in a modern enterprise environment? my immediate thought was windows management instrumentation (wmi). modern versions of windows can connect to remote wmi instances using the ws-management (wsman) protocol but for legacy reasons wmi still supports a dcom transport. one use case for wmi is to scan enterprise machines for potentially malicious behavior. one of the reasons for this resurgence is powershell (which is implemented in .net) having easy to use support for wmi. perhaps ps or .net itself will be vulnerable to this attack if they try and access a compromised workstation in the network? looking at msdn, .net supports wmi through the system.management namespace. this has existed since the beginning of .net. it supports remote access to wmi and considering the age of the classes it predates wsman and so almost certainly uses dcom under the hood. on the ps front there’s support for wmi through cmdlets such as get-wmiobject. ps version 3 (introduced in windows 8 and server 2008) added a new set of cmdlets including get-ciminstance. reading the related link it’s clear why the cim cmdlets were introduced, support for wsman, and the link explicitly points out that the “old” wmi cmdlets uses dcom. at this point we could jump straight into re of the .net and ps class libraries, but there’s an easier way. it’s likely we’d be able to see whether the .net client queries for imanagedobject by observing the dcom rpc traffic to a wmi server. wireshark already has a dcom dissector saving us a lot of trouble. for a test i set up two vms, one with windows server 2016 acting as a domain controller and one with windows 10 as a client on the domain. then from a domain administrator on the client i issued a simple wmi ps command ‘get-wmiobject win32_process -computername dc.network.local’ while monitoring the network using wireshark. the following image shows what i observed: the screenshot shows the initial creation request for the wmi dcom object on the dc server (192.168.56.50) from the ps client (192.168.56.102). we can see it’s querying for the iwbemloginclientid interface which is the part of the initialization process (as documented in ms-wmi). the client then tries to request a few other interfaces; notably it asks for imanagedobject. this almost certainly indicates that a client using the ps wmi cmdlets would be vulnerable. in order to test whether this is really a vulnerability we’ll need a fake wmi server. this would seem like it would be quite a challenge, but all we need to do is modify the registration for the winmgmt service to point to our fake implementation. as long as that service then registers a com class with the clsid {8bc3f05e-d86b-11d0-a075-00c04fb68820} the com activator will start the service and serve any client an instance of our fake wmi object. if we look back at our network capture it turns out that the query for imanagedobject isn’t occurring on the main class, but instead on the iwbemservices object returned from iwbemlevel1login::ntlmlogin. but that’s okay, it just adds a bit extra boilerplate code. to ensure it’s working we’ll implement the following code which will tell the deserialization code to look for an unknown assembly called badgers. [serializable, comvisible(true)] public class fakewbemservices : iwbemservices, iserializable { public void getobjectdata(serializationinfo info, streamingcontext context) { info.assemblyname = "badgers, version=4.0.0.0"; info.fulltypename = "system.badgers.test"; } // rest of fake implementation... } if we successfully injected a serialized stream then we’d expect the ps process to try and lookup a badgers.dll file and using process monitor that’s exactly what we find. chaining up the deserializerwhen exploiting the deserialization for local privilege escalation we can be sure that we can connect back to the server and run an arbitrary delegate. we don’t have any such guarantees in the rce case. if the wmi client has default windows firewall rules enabled then we almost certainly wouldn’t be able to connect to the rpc endpoint made by the delegate object. we also need to be allowed to login over the network to the machine running the wmi client, our compromised machine might not have a login to the domain or the enterprise policy might block anyone but the owner from logging in to the client machine. we therefore need a slightly different plan, instead of actively attacking the client through exposing a new delegate object we’ll instead pass it a byte stream which when deserialized executes a desired action. in an ideal world we’d find that one serializable class which just executes arbitrary code for us. sadly (as far as i know of) no such class exists. so instead we’ll need to find a series of “gadget” classes which when chained together perform the desired effect. so in this situation i tend to write some quick analysis tools, .net supports a pretty good reflection api so finding basic information such as whether a class is serializable or which interfaces a class supports is pretty easy to do. we also need a list of assemblies to check, the quickest way i know of is to use the gacutil utility installed as part of the .net sdk (and so installed with visual studio). run the command gacutil /l > assemblies.txt to create a list of assembly names you can load and process. for a first pass we’ll look for any classes which are serializable and have delegates in them, these might be classes which when an operation is performed will execute arbitrary code. with our list of assemblies we can write some simple code like the following to find those classes, just call findserializabletypes for each assembly name string: static bool isdelegatetype(type t) { return typeof(delegate).isassignablefrom(t); } static bool hasserializeddelegate(type t) { // custom serialized objects rarely serialize their delegates. if (typeof(iserializable).isassignablefrom(t)) { return false; } foreach (fieldinfo field in formatterservices.getserializablemembers(t)) { if (isdelegatetype(field.fieldtype)) { return true; } } } static void findserializabletypes(string assembly_name) { assembly asm = assembly.load(assembly_name); var types = asm.gettypes().where(t => t.isserializable && t.isclass && !t.isabstract && !isdelegatetype(t) && hasserializeddelegate(t)); foreach (type type in types) { console.writeline(type.fullname); } } across my system this analysis only resulted in around 20 classes, and of those many were actually in the f# libraries which are not distributed in a default installation. however one class did catch my eye, system.collections.generic.comparisoncomparer. you can find the implementation in the reference source, but as it’s so simple here it is in its entirety: public delegate int comparison(t x, t y); [serializable] internal class comparisoncomparer : comparer { private readonly comparison _comparison; public comparisoncomparer(comparison comparison) { _comparison = comparison; } public override int compare(t x, t y) { return this._comparison(x, y); } } this class wraps a comparison delegate which takes two generic parameters (of the same type) and returns an integer, calling the delegate to implement the icomparer interface. while the class is internal its creation is exposed through comparer::create static method. this is the first part of the chain, with this class and a bit of massaging of serialized delegates we can chain icomparer::compare to process::start and get an arbitrary process created. now we need the next part of the chain, calling this comparer object with arbitrary arguments. comparer objects are used a lot in the generic .net collection classes and many of these collection classes also have custom deserialization code. in this case we can abuse the sortedset class, on deserialization it rebuilds its set using an internal comparer object to determine the sort order. the values passed to the comparer are the entries in the set, which is under our complete control. let’s write some test code to check it works as we expect: static void typeconfusedelegate(comparison comp) { fieldinfo fi = typeof(multicastdelegate).getfield("_invocationlist", bindingflags.nonpublic | bindingflags.instance); object[] invoke_list = comp.getinvocationlist(); // modify the invocation list to add process::start(string, string) invoke_list[1] = new func(process.start); fi.setvalue(comp, invoke_list); } // create a simple multicast delegate. delegate d = new comparison(string.compare); comparison d = (comparison) multicastdelegate.combine(d, d); // create set with original comparer. icomparer comp = comparer.create(d); sortedset set = new sortedset(comp); // setup values to call calc.exe with a dummy argument. set.add("calc"); set.add("adummy"); typeconfusedelegate(d); // test serialization. binaryformatter fmt = new binaryformatter(); memorystream stm = new memorystream(); fmt.serialize(stm, set); stm.position = 0; fmt.deserialize(stm);// calculator should execute during deserialize. the only weird thing about this code is typeconfusedelegate. it’s a long standing issue that .net delegates don’t always enforce their type signature, especially the return value. in this case we create a two entry multicast delegate (a delegate which will run multiple single delegates sequentially), setting one delegate to string::compare which returns an int, and another to process::start which returns an instance of the process class. this works, even when deserialized and invokes the two separate methods. it will then return the created process object as an integer, which just means it will return the pointer to the instance of the process object. so we end up with chain which looks like the following: while this is a pretty simple chain it has a couple of problems which makes it less than ideal for our use: the comparer::create method and the corresponding class were only introduced in .net 4.5, which covers windows 8 and above but not windows 7.the exploit relies in part on a type confusion of the return value of the delegate. while it’s only converting the process object to an integer this is somewhat less than ideal and could have unexpected side effects.starting a process is a bit on the noisy side, it would be nicer to load our code from memory. so we’ll need to find something better. we want something which works at a minimum on .net 3.5, which would be the version on windows 7 which windows update would automatically update you to. also it shouldn’t rely on undefined behaviour or loading our code from outside of the dcom channel such as over a http connection. sounds like a challenge to me.improving the chainwhile looking at some of the other classes which are serializable i noticed a few in the system.workflow.componentmodel.serialization namespace. this namespace contains classes which are part of the windows workflow foundation, which is a set of libraries to build execution pipelines to perform a series of tasks. this alone sounds interesting, and it turns out i have exploited the core functionality before as a bypass for code integrity in windows powershell. this lead me to finding the objectserializedref class. this looks very much like a class which will deserialize any object type, not just serialized ones. if this was the case then that would be a very powerful primitive for building a more functional deserialization chain. [serializable] private sealed class objectserializedref : iobjectreference, ideserializationcallback { private type type; private object[] memberdatas; [nonserialized] private object returnedobject; object iobjectreference.getrealobject(streamingcontext context) { returnedobject = formatterservices.getuninitializedobject(type); return this.returnedobject; } void ideserializationcallback.ondeserialization(object sender) { string[] array = null; memberinfo[] serializablemembers = formatterservicesnoserializablecheck.getserializablemembers( type, out array); formatterservices.populateobjectmembers(returnedobject, serializablemembers, memberdatas); } } looking at the implementation the class was used as a serialization surrogate exposed through the activitiysurrogateselector class. this is a feature of the .net serialization api, you can specify a “surrogate selector” during the serialization process which will replace an object with surrogate class. when the stream is deserialized this surrogate class contains enough information to reconstruct the original object. one use case is to handle the serialization of non-serializable classes, but objectserializedref goes beyond a specific use case and allows you to deserialize anything. a test was in order: // definitely non-serializable class. class nonserializable { private string _text; public nonserializable(string text) { _text = text; } public override string tostring() { return _text; } } // custom serialization surrogate class mysurrogateselector : surrogateselector { public override iserializationsurrogate getsurrogate(type type, streamingcontext context, out isurrogateselector selector) { selector = this; if (!type.isserializable) { type t = type.gettype("activitysurrogateselector+objectsurrogate"); return (iserializationsurrogate)activator.createinstance(t); } return base.getsurrogate(type, context, out selector); } } static void testobjectserializedref() { binaryformatter fmt = new binaryformatter(); memorystream stm = new memorystream(); fmt.surrogateselector = new mysurrogateselector(); fmt.serialize(stm, new nonserializable("hello world!")); stm.position = 0; // should print hello world!. console.writeline(fmt.deserialize(stm)); } the objectsurrogate class seems to work almost too well. this class totally destroys any hope of securing an untrusted binaryformatter stream and it’s available from .net 3.0. any class which didn’t mark itself as serializable is now a target. it’s going to be pretty easy to find a class which while invoke an arbitrary delegate during deserialization as the developer will not be doing anything to guard against such an attack vector. now just to choose a target to build out our deserialization chain. i could have chosen to poke further at the workflow classes, but the api is horrible (in fact in .net 4 microsoft replaced the old apis with a new, slightly nicer one). instead i’ll pick a really easy to use target, language integrated query (linq). linq was introduced in .net 3.5 as a core language feature. a new sql-like syntax was introduced to the c# and vb compilers to perform queries across enumerable objects, such as lists or dictionaries. an example of the syntax which filters a list of names based on length and returns the list uppercased is as follows: string[] names = { "alice", "bob", "carl" }; ienumerable query = from name in names where name.length > 3 orderby name select name.toupper(); foreach (string item in query) { console.writeline(item); } you can also view linq not as a query syntax but instead a way of doing list comprehension in .net. if you think of ‘select’ as equivalent to ‘map’ and ‘where’ to ‘filter’ it might make more sense. underneath the query syntax is a series of methods implemented in the system.linq.enumerable class. you can write it using normal c# syntax instead of the query language; if you do the previous example becomes the following: ienumerable query = names.where(name => name.length > 3) .orderby(name => name) .select(name => name.toupper()); the methods such as where take two parameters, a list object (this is hidden in the above example) and a delegate to invoke for each entry in the enumerable list. the delegate is typically provided by the application, however there’s nothing to stop you replacing the delegates with system methods. the important thing to bear in mind is that the delegates are not invoked until the list is enumerated. this means we can build an enumerable list using linq methods, serialize it using the objectsurrogate (linq classes are not themselves serializable) then if we can force the deserialized list to be enumerated it will execute arbitrary code. using linq as a primitive we can create a list which when enumerated maps a byte array to an instance of a type in that byte array by the following sequence: the only tricky part is step 2, we’d like to extract a specific type but our only real option is to use the enumerable.join method which requires some weird kludges to get it to work. a better option would have been to use enumerable.zip but that was only introduced in .net 4. so instead we’ll just get all the types in the loaded assembly and create them all, if we just have one type then this isn’t going to make any difference. how does the implementation look in c#? static ienumerable createlinq(byte[] assembly) { list base_list = new list(); base_list.add(assembly); var get_types_del = (func>) delegate.createdelegate( typeof(func>), typeof(assembly).getmethod("gettypes")); return base_list.select(assembly.load) .selectmany(get_types_del) .select(activator.createinstance); } the only non-obvious part of the c# implementation is the delegate for assembly::gettypes. what we need is a delegate which takes an assembly object and returns a list of type objects. however as gettypes is an instance method the default would be to capture the assembly class and store it inside the delegate object, which would result in a delegate which took no parameters and returned a list of type. we can get around this by using the reflection apis to create an open delegate to an instance member. an open delegate doesn’t store the object instance, instead it exposes it as an additional assembly parameter, exactly what we want. with our enumerable list we can get the assembly loaded and our own code executed, but how do we get the list enumerated to start the chain? for this decided i’d try and find a class which when calling tostring (a pretty common method) would enumerate the list. this is easy in java, almost all the collection classes have this exact behavior. sadly it seems .net doesn't follow java in this respect. so i modified my analysis tools to try and hunt for gadgets which would get us there. to cut a long story short i found a chain from tostring to ienumerable through three separate classes. the chain looks something like the following: are we done yet? no, just one more step, we need to call tostring on an arbitrary object during deserialization. of course i wouldn’t have chosen tostring if i didn’t already have a method to do this. in this final case i’ll go back to abusing poor, old, hashtable. during deserialization of the hashtable class it will rebuild its key set, which we already know about as this is how i exploited serialization for local eop. if two keys are equal then the deserialization will fail with the hashtable throwing an exception, resulting in running the following code: throw new argumentexception( environment.getresourcestring("argument_addingduplicate__", buckets[bucketnumber].key, key)); it’s not immediately obvious why this would be useful. but perhaps looking at the implementation of getresourcestring will make it clearer: internal static string getresourcestring(string key, params object[] values) { string s = getresourcestring(key); return string.format(cultureinfo.currentculture, s, values); } the key is passed to getresourcestring within the values array as well as a reference to a resource string. the resource string is looked up and along with the key passed to string.format. the resulting resource string has formatting codes so when string.format encounters the non-string value it calls tostring on the object to format it. this results in tostring being called during deserialization kicking off the chain of events which leads to us loading an arbitrary .net assembly from memory and executing code in the context of the wmi client. you can see the final implementation in latest the poc i’ve added to the issue tracker.conclusionsmicrosoft fixed the rce issue by ensuring that the system.management classes never directly creates an rcw for a wmi object. however this fix doesn’t affect any other use of dcom in .net, so privileged .net dcom servers are still vulnerable and other remote dcom applications could also be attacked. also this should be a lesson to never deserialize untrusted data using the .net binaryformatter class. it’s a dangerous thing to do at the best of times, but it seems that the developers have abandoned any hope of making secure serializable classes. the presence of objectsurrogate effectively means that every class in the runtime is serializable, whether the original developer wanted them to be or not. and as a final thought you should always be skeptical about the security implementation of middleware especially if you can’t inspect what it does. the fact that the issue with imanagedobject is designed in and hard to remove makes it very difficult to fix correctly. kategorie: hacking & security facebook admits it is being used as propaganda tool by ‘malicious actors’ sophos naked security - 28 duben, 2017 - 18:13 facebook's soul-searching report sets itself the challenge of knowing itself kategorie: hacking & security, viry a červi opilý muž v silicon valley napadl bezpečnostního robota, vyvázl jen s odřeninami zive.cz - bezpečnost - 28 duben, 2017 - 17:13 pokud máte rádi terminátora, tato zpráva pro vás bude nejspíše slabé kafe, ale stojí určitě za zmínku. množství nejrůznějších robotů kolem nás se totiž rychle zvětšuje a mezi nejpokrokovější místa patří pochopitelně silicon valey, kde je i velká řada robotických startupů. právě v této oblasti na ... kategorie: hacking & security threatpost news wrap, april 28, 2017 threatpost - 28 duben, 2017 - 16:28 mike mimoso and chris brook recap this year's source boston conference and discuss the week in news, including the long term implications of the nsa's doublepulsar exploit, and the hipchat breach. kategorie: hacking & security feedsportal.com - this domain may be for sale! the h security - 28 duben, 2017 - 15:00 click here for more information find the best information and most relevant links on all topics related to feedsportal.com. kategorie: hacking & security feedsportal.com - this domain may be for sale! securityworld.cz - 28 duben, 2017 - 15:00 click here for more information find the best information and most relevant links on all topics related to feedsportal.com. kategorie: hacking & security lawmaker calls on isps to stop customers being hit by viruses sophos naked security - 28 duben, 2017 - 14:39 australian minister says government is considering moving towards 'active defence ... blocking or diverting malicious traffic' kategorie: hacking & security, viry a červi secure shipping of physical data carriers to and from a cloud service provider infosec institute resources - 28 duben, 2017 - 14:00 a cloud environment is ideally suited to store and analyze large amounts of data. if more storage space, cpu or memory resources are needed, services can usually be upgraded with ease. this situation is likely to occur because data tends to grow over time. this data could, for instance, be a sales database, ingesting logs […] the post secure shipping of physical data carriers to and from a cloud service provider appeared first on infosec resources. kategorie: hacking & security sports fans protest at plans to scan their faces as they head for the match sophos naked security - 28 duben, 2017 - 13:11 police to use facial recognition to match champions league fans to 'persons of interest' as they arrive for the uefa cup final kategorie: hacking & security, viry a červi fcc: net neutrality is ‘politically motivated government overreach’ sophos naked security - 28 duben, 2017 - 12:27 fcc chief signals assault on rules from the days of ma bell used by obama to guarantee net neutrality kategorie: hacking & security, viry a červi use of dns tunneling for c&c communications kaspersky securelist - 28 duben, 2017 - 11:59 – say my name. – 127.0.0.1! – you are goddamn right. network communication is a key function for any malicious program. yes, there are exceptions, such as cryptors and ransomware trojans that can do their job just fine without using the internet. however, they also require their victims to establish contact with the threat actor so they can send the ransom and recover their encrypted data. if we omit these two and have a look at the types of malware that have no communication with a c&c and/or threat actor, all that remains are a few outdated or extinct families of malware (such as trojan-arcbomb), or irrelevant, crudely made prankware that usually does nothing more than scare the user with screamers or switches mouse buttons. malware has come a long way since the morris worm, and the authors never stop looking for new ways to maintain communication with their creations. some create complex, multi-tier authentication and management protocols that can take weeks or even months for analysists to decipher. others go back to the basics and use irc servers as a management host – as we saw in the recent case of mirai and its numerous clones. often, virus writers don’t even bother to run encryption or mask their communications: instructions and related information is sent in plain text, which comes in handy for a researcher analyzing the bot. this approach is typical of incompetent cybercriminals or even experienced programmers who don’t have much experience developing malware. however, you do get the occasional off-the-wall approaches that don’t fall into either of the above categories. take, for instance, the case of a trojan that kaspersky lab researchers discovered in mid-march and which establishes a dns tunnel for communication with the c&c server. the malicious program in question is detected by kaspersky lab products as backdoor.win32.denis. this trojan enables an intruder to manipulate the file system, run arbitrary commands and run loadable modules. encryption just like lots of other trojans before it, backdoor.win32.denis extracts the addresses of the functions it needs to operate from loaded dlls. however, instead of calculating the checksums of the names in the export table (which is what normally happens), this trojan simply compares the names of the api calls against a list. the list of api names is encrypted by subtracting 128 from each symbol of the function name. it should be noted that the bot uses two versions of encryption: for api call names and the strings required for it to operate, it does the subtraction from every byte; for dlls, it subtracts from every other byte. to load dlls using their names, loadlibraryw is used, meaning wide strings are required. ‘decrypting’ strings in the trojan names of api functions and libraries in encrypted format it should also be noted that only some of the functions are decrypted like this. in the body of the trojan, references to extracted functions alternate with references to functions received from the loader. c&c communication the principle behind a dns tunnel’s operation can be summed up as: “if you don’t know, ask somebody else”. when a dns server receives a dns request with an address to be resolved, the server starts looking for it in its database. if the record isn’t found, the server sends a request to the domain stated in the database. let’s see how this works when a request arrives with the url y3vyaw9zaxr5.example.com to be resolved. the dns server receives this request and first attempts to find the domain extension ‘.com’, then ‘example.com’, but then it fails to find ‘y3vyaw9zaxr5.example.com’ in its database. it then forwards the request to example.com and asks it if such a name is known to it. in response, example.com is expected to return the appropriate ip; however, it can return an arbitrary string, including c&c instructions. dump of backdoor.win32.denis traffic this is what backdoor.win32.denis does. the dns request is sent first to 8.8.8.8, then forwarded to z.teriava[.]com. everything that comes before this address is the text of the request sent to the c&c. here is the response: dns packet received in response to the first request obviously, the request sent to the c&c is encrypted with base64. the original request is a sequence of zeros and the result of gettickcount at the end. the bot subsequently receives its unique id and uses it for identification at the start of the packet. the instruction number is sent in the fifth dword, if we count from the start of the section highlighted green in the diagram above. next comes the size of the data received from c&c. the data, packed using zlib, begins immediately after that. the unpacked c&c response the first four bytes are the data size. all that comes next is the data, which may vary depending on the type of instruction. in this case, it’s the unique id of the bot, as mentioned earlier. we should point out that the data in the packet is in big-endian format. the bot id (highlighted) is stated at the beginning of each request sent to the c&c c&c instructions altogether, there are 16 instructions the trojan can handle, although the number of the last instruction is 20. most of the instructions concern interaction with the file system of the attacked computer. also, there are capabilities to gain info about open windows, call an arbitrary api or obtain brief info about the system. let us look into the last of these in more detail, as this instruction is executed first. complete list of c&c instructions information about the infected computer, sent to the c&c as can be seen in the screenshot above, the bot sends the computer name and the user name to the c&c, as well as the info stored in the registry branch software\insufficient\insufficient.ini: time when that specific instruction was last executed. (if executed for the first time, ‘getsystemtimeasfiletime’ is returned, and the variable bouncetime is set, in which the result is written); usagecount from the same registry branch. information about the operating system and the environment is also sent. this info is obtained with the help of netwkstagetinfo. the data is packed using zlib. the dns response prior to base64 encryption the fields in the response are as follows (only the section highlighted in red with data and size varies depending on the instruction): bot id; size of the previous c&c response; the third dword in the c&c response; always equals 1 for a response; gettickcount(); size of data after the specified field; size of response; actual response. after the registration stage is complete, the trojan begins to query the c&c in an infinite loop. when no instructions are sent, the communication looks like a series of empty queries and responses. sequence of empty queries sent to the c&c conclusion the use of a dns tunneling for communication, as used by backdoor.win32.denis, is a very rare occurrence, albeit not unique. a similar technique was previously used in some pos trojans and in some apts (e.g. backdoor.win32.gulpix in the plugx family). however, this use of the dns protocol is new on pcs. we presume this method is likely to become increasingly popular with malware writers. we’ll keep an eye on how this method is implemented in malicious programs in future. md5 facec411b6d6aa23ff80d1366633ea7a 018433e8e815d9d2065e57b759202edc 1a4d58e281103fea2a4ccbfab93f74d2 5394b09cf2a0b3d1caaecc46c0e502e3 5421781c2c05e64ef20be54e2ee32e37 kategorie: hacking & security, viry a červi google tightens noose on http: chrome to stick 'not secure' on pages with search fields linuxsecurity.com - 28 duben, 2017 - 11:42 linuxsecurity.com: google is giving web developers six months to prepare for the next phase of its plan to mark all http pages as 'not secure'. october will mark stage two of google's plan to label all http pages as 'not secure' in chrome. kategorie: hacking & security pemcracker - tool for cracking pem files linuxsecurity.com - 28 duben, 2017 - 11:40 linuxsecurity.com: pemcracker is a tool for cracking pem files that are encrypted and have a password. the purpose is to attempt to recover the password for encrypted pem files while utilising all the cpu cores. kategorie: hacking & security new macos malware, signed with legit apple id, found spying on https traffic the hacker news - 28 duben, 2017 - 10:57 many people believe that they are much less likely to be bothered by malware if they use a mac computer, but is it really true? unfortunately, no. according to the mcafee labs, malware attacks on apple's mac computers were up 744% in 2016, and its researchers have discovered nearly 460,000 mac malware samples, which is still just a small part of overall mac malware out in the wild. today, kategorie: hacking & security the security weaknesses of smartphones infosec institute resources - 28 duben, 2017 - 01:28 introduction our last article started off our series upon the security weaknesses and vulnerabilities which are found on wireless devices, especially those of smartphones. as it was discussed, the evolution of computer technology has come a very long way since the first mainframe machines came out in the 1950s and into the 1960s. it has […] the post the security weaknesses of smartphones appeared first on infosec resources. kategorie: hacking & security sonarqube: a hidden gem infosec institute resources - 28 duben, 2017 - 01:22 sonarqube is an open source quality management software that analyzes and measures the technical quality of project portfolio to a method which essentially means that it helps analyze the quality of our source code. formerly known as sonar, it is written in java but can analyze code for more than 20 different languages such as: […] the post sonarqube: a hidden gem appeared first on infosec resources. kategorie: hacking & security 1 2 3 4 5 6 7 8 9 … následující › poslední » přihlášení přihlásit pomocí openid: co je openid? uživatelské jméno: * heslo: * přihlásit pomocí openid zrušit openid přihlášení vytvořit nový účet zaslat nové heslo poslední komentáře super před 10 týdnů 1 den :) o tobě psal před 26 týdnů 1 den umím zjistit skrytá čísla před 34 týdny 5 dnů youtube před 48 týdnů 5 dnů 2 stejné ip adresy před 1 rok 4 dny další konference doporučujeme gnu/linux & bsd oss víkend bratislava, 17. - 18. jún 2017 – cfp state of the commons – creative commons 2016 postřehy z bezpečnosti: watsone, s cloudy je to nuda lakka 2.0 rekordní trest: 27 let za hackování a krádeže platebních karet [stalo se] další it news hikey 960, superrychlý konkurent raspberry pi s čipem huawei kirin 960 nový computer: travel hacking, jak ochránit facebook a hromada testů týden živě: první američané dostanou chytrá auta googlu. iptv je budoucnost televize proměnili jsme raspberry pi v chytrou hlasovou asistentku google home podívejte se na fúzní reaktor tokamak st40 další security vulnerabilities & exploits emby mediaserver 3.2.5 directory traversal file disclosure vulnerability emby mediaserver 3.2.5 reflected xss vulnerability emby mediaserver 3.2.5 password reset vulnerability emby mediaserver 3.2.5 boolean-based blind sql injection vulnerability apple ios 10.2 & 10.3 - control panel denial of service vulnerability *youtube další home články projekty služby konference a výstavy virové zpravodajství hacking filmy literatura this work is licensed under a creative commons attribution-share alike 3.0 unported license. cc-by-sa security-portal.cz | secured by paranoid sense | we hack to learn by dr. radut


Here you find all texts from your page as Google (googlebot) and others search engines seen it.

Words density analysis:

Numbers of all words: 8202

One word

Two words phrases

Three words phrases

the - 7.08% (581)
com - 2.23% (183)
for - 1.6% (131)
and - 1.55% (127)
object - 1.41% (116)
all - 1.28% (105)
this - 1.16% (95)
int - 1.13% (93)
net - 1% (82)
are - 0.99% (81)
which - 0.88% (72)
pro - 0.87% (71)
able - 0.84% (69)
class - 0.82% (67)
.net - 0.82% (67)
comp - 0.78% (64)
type - 0.78% (64)
get - 0.77% (63)
that - 0.65% (53)
string - 0.63% (52)
use - 0.6% (49)
age - 0.59% (48)
can - 0.59% (48)
security - 0.59% (48)
delegate - 0.55% (45)
our - 0.55% (45)
call - 0.52% (43)
serve - 0.52% (43)
with - 0.52% (43)
tor - 0.52% (43)
server - 0.5% (41)
hack - 0.48% (39)
act - 0.48% (39)
name - 0.46% (38)
you - 0.45% (37)
pos - 0.43% (35)
interface - 0.43% (35)
one - 0.43% (35)
new - 0.41% (34)
code - 0.41% (34)
list - 0.41% (34)
serialize - 0.41% (34)
return - 0.4% (33)
not - 0.39% (32)
but - 0.39% (32)
from - 0.38% (31)
hacking - 0.38% (31)
info - 0.38% (31)
serialization - 0.37% (30)
serializable - 0.37% (30)
out - 0.37% (30)
its - 0.35% (29)
manage - 0.35% (29)
run - 0.35% (29)
rce - 0.35% (29)
implement - 0.34% (28)
format - 0.34% (28)
any - 0.33% (27)
here - 0.33% (27)
time - 0.33% (27)
have - 0.3% (25)
process - 0.3% (25)
look - 0.3% (25)
work - 0.29% (24)
has - 0.29% (24)
source - 0.28% (23)
method - 0.28% (23)
data - 0.28% (23)
2017 - 0.28% (23)
client - 0.28% (23)
was - 0.28% (23)
kategorie - 0.27% (22)
wmi - 0.27% (22)
now - 0.27% (22)
will - 0.27% (22)
compare - 0.26% (21)
assembly - 0.26% (21)
it’s - 0.26% (21)
how - 0.26% (21)
over - 0.26% (21)
create - 0.26% (21)
kategorie: - 0.24% (20)
objects - 0.24% (20)
surrogate - 0.24% (20)
duben, - 0.24% (20)
like - 0.24% (20)
when - 0.24% (20)
dcom - 0.24% (20)
managed - 0.24% (20)
red - 0.24% (20)
would - 0.24% (20)
serialized - 0.24% (20)
set - 0.24% (20)
bit - 0.24% (20)
den - 0.24% (20)
result - 0.23% (19)
thing - 0.23% (19)
runtime - 0.23% (19)
find - 0.23% (19)
some - 0.23% (19)
service - 0.23% (19)
using - 0.23% (19)
two - 0.23% (19)
classes - 0.23% (19)
reg - 0.23% (19)
back - 0.23% (19)
led - 0.22% (18)
text - 0.22% (18)
ever - 0.22% (18)
then - 0.22% (18)
just - 0.22% (18)
cut - 0.22% (18)
select - 0.22% (18)
deserialization - 0.22% (18)
c&c - 0.22% (18)
first - 0.21% (17)
let - 0.21% (17)
exploit - 0.21% (17)
follow - 0.21% (17)
main - 0.21% (17)
struct - 0.21% (17)
such - 0.2% (16)
arbitrary - 0.2% (16)
instead - 0.2% (16)
instance - 0.2% (16)
system - 0.2% (16)
start - 0.2% (16)
add - 0.2% (16)
what - 0.2% (16)
resource - 0.2% (16)
too - 0.2% (16)
end - 0.2% (16)
there - 0.18% (15)
comparer - 0.18% (15)
used - 0.18% (15)
names - 0.18% (15)
could - 0.18% (15)
chain - 0.18% (15)
load - 0.18% (15)
pass - 0.17% (14)
ccw - 0.17% (14)
cia - 0.17% (14)
know - 0.17% (14)
other - 0.17% (14)
static - 0.17% (14)
public - 0.17% (14)
bot - 0.17% (14)
need - 0.17% (14)
also - 0.17% (14)
case - 0.17% (14)
way - 0.17% (14)
domain - 0.16% (13)
enumerable - 0.16% (13)
implementation - 0.16% (13)
resources - 0.16% (13)
deserialize - 0.16% (13)
real - 0.16% (13)
part - 0.16% (13)
request - 0.16% (13)
tool - 0.16% (13)
imanagedobject - 0.16% (13)
even - 0.16% (13)
following - 0.16% (13)
matter - 0.16% (13)
sent - 0.16% (13)
instruction - 0.16% (13)
only - 0.16% (13)
side - 0.16% (13)
windows - 0.16% (13)
api - 0.16% (13)
gets - 0.15% (12)
value - 0.15% (12)
example - 0.15% (12)
more - 0.15% (12)
query - 0.15% (12)
post - 0.15% (12)
response - 0.15% (12)
try - 0.15% (12)
types - 0.15% (12)
key - 0.15% (12)
see - 0.13% (11)
mac - 0.13% (11)
ale - 0.13% (11)
function - 0.13% (11)
they - 0.13% (11)
open - 0.13% (11)
trojan - 0.13% (11)
object. - 0.13% (11)
does - 0.13% (11)
services - 0.13% (11)
dns - 0.13% (11)
each - 0.13% (11)
secure - 0.13% (11)
write - 0.13% (11)
malware - 0.13% (11)
selector - 0.13% (11)
very - 0.13% (11)
context - 0.13% (11)
news - 0.13% (11)
stream - 0.13% (11)
test - 0.12% (10)
hash - 0.12% (10)
issue - 0.12% (10)
point - 0.12% (10)
support - 0.12% (10)
most - 0.12% (10)
execute - 0.12% (10)
however - 0.12% (10)
communication - 0.12% (10)
put - 0.12% (10)
gem - 0.12% (10)
turned - 0.12% (10)
system. - 0.12% (10)
own - 0.12% (10)
information - 0.11% (9)
through - 0.11% (9)
less - 0.11% (9)
their - 0.11% (9)
while - 0.11% (9)
itself - 0.11% (9)
long - 0.11% (9)
binary - 0.11% (9)
byte - 0.11% (9)
field - 0.11% (9)
table - 0.11% (9)
should - 0.11% (9)
turns - 0.11% (9)
returned - 0.11% (9)
exposed - 0.11% (9)
vulnerability - 0.11% (9)
computer - 0.11% (9)
linux - 0.11% (9)
make - 0.11% (9)
come - 0.11% (9)
- 0.11% (9)
we’ll - 0.11% (9)
ports - 0.11% (9)
developer - 0.11% (9)
microsoft - 0.11% (9)
lab - 0.1% (8)
don’t - 0.1% (8)
com. - 0.1% (8)
další - 0.1% (8)
faces - 0.1% (8)
calling - 0.1% (8)
interface. - 0.1% (8)
linq - 0.1% (8)
known - 0.1% (8)
access - 0.1% (8)
fine - 0.1% (8)
file - 0.1% (8)
guid - 0.1% (8)
void - 0.1% (8)
(type - 0.1% (8)
attack - 0.1% (8)
tostring - 0.1% (8)
about - 0.1% (8)
implemented - 0.1% (8)
oss - 0.1% (8)
network - 0.1% (8)
management - 0.1% (8)
binaryformatter - 0.1% (8)
version - 0.1% (8)
ways - 0.1% (8)
blog - 0.1% (8)
stm - 0.1% (8)
application - 0.1% (8)
document - 0.09% (7)
privilege - 0.09% (7)
actual - 0.09% (7)
- 0.09% (7)
invoke - 0.09% (7)
instructions - 0.09% (7)
works - 0.09% (7)
bstr - 0.09% (7)
connect - 0.09% (7)
var - 0.09% (7)
web - 0.09% (7)
track - 0.09% (7)
did - 0.09% (7)
surrogateselector - 0.09% (7)
class. - 0.09% (7)
fmt - 0.09% (7)
written - 0.09% (7)
rcw - 0.09% (7)
check - 0.09% (7)
registration - 0.09% (7)
custom - 0.09% (7)
enumerate - 0.09% (7)
interfaces - 0.09% (7)
interop - 0.09% (7)
might - 0.09% (7)
read - 0.09% (7)
equal - 0.09% (7)
comparer - 0.09% (7)
methods - 0.09% (7)
malicious - 0.09% (7)
build - 0.09% (7)
gettype - 0.09% (7)
memory - 0.09% (7)
looking - 0.09% (7)
something - 0.09% (7)
simple - 0.09% (7)
delegates - 0.09% (7)
remote - 0.07% (6)
_object - 0.07% (6)
infosec - 0.07% (6)
being - 0.07% (6)
perform - 0.07% (6)
extra - 0.07% (6)
search - 0.07% (6)
size - 0.07% (6)
count - 0.07% (6)
(as - 0.07% (6)
plan - 0.07% (6)
pem - 0.07% (6)
comes - 0.07% (6)
where - 0.07% (6)
hacker - 0.07% (6)
google - 0.07% (6)
program - 0.07% (6)
encrypted - 0.07% (6)
looks - 0.07% (6)
found - 0.07% (6)
delegate. - 0.07% (6)
hresult - 0.07% (6)
code. - 0.07% (6)
smartphones - 0.07% (6)
wikileaks - 0.07% (6)
returns - 0.07% (6)
name. - 0.07% (6)
fix - 0.07% (6)
number - 0.07% (6)
inside - 0.07% (6)
word - 0.07% (6)
reference - 0.07% (6)
(string - 0.07% (6)
almost - 0.07% (6)
language - 0.07% (6)
lies - 0.07% (6)
take - 0.07% (6)
into - 0.07% (6)
following: - 0.07% (6)
introduced - 0.07% (6)
always - 0.07% (6)
gain - 0.07% (6)
during - 0.07% (6)
many - 0.07% (6)
really - 0.07% (6)
security, - 0.07% (6)
viry - 0.07% (6)
červi - 0.07% (6)
whether - 0.07% (6)
private - 0.07% (6)
feed - 0.07% (6)
type. - 0.07% (6)
ienumerable - 0.07% (6)
bad - 0.07% (6)
link - 0.06% (5)
values - 0.06% (5)
buffer - 0.06% (5)
under - 0.06% (5)
common - 0.06% (5)
http - 0.06% (5)
actually - 0.06% (5)
cmdlets - 0.06% (5)
last - 0.06% (5)
ask - 0.06% (5)
generic - 0.06% (5)
functions - 0.06% (5)
example.com - 0.06% (5)
those - 0.06% (5)
series - 0.06% (5)
uses - 0.06% (5)
these - 0.06% (5)
likely - 0.06% (5)
security-portal.cz - 0.06% (5)
rok - 0.06% (5)
dnů - 0.06% (5)
před - 0.06% (5)
isn’t - 0.06% (5)
string. - 0.06% (5)
send - 0.06% (5)
pretty - 0.06% (5)
calls - 0.06% (5)
nice - 0.06% (5)
installed - 0.06% (5)
easy - 0.06% (5)
array - 0.06% (5)
it. - 0.06% (5)
above - 0.06% (5)
supports - 0.06% (5)
konference - 0.06% (5)
internet - 0.06% (5)
didn’t - 0.06% (5)
hashtable - 0.06% (5)
order - 0.06% (5)
been - 0.06% (5)
hit - 0.06% (5)
executed - 0.06% (5)
syntax - 0.06% (5)
rest - 0.06% (5)
machine - 0.06% (5)
terse - 0.06% (5)
register - 0.06% (5)
discovered - 0.06% (5)
visible - 0.06% (5)
store - 0.06% (5)
allow - 0.06% (5)
login - 0.06% (5)
list. - 0.06% (5)
however, - 0.06% (5)
extract - 0.06% (5)
threat - 0.06% (5)
require - 0.06% (5)
local - 0.06% (5)
term - 0.06% (5)
bezpečnost - 0.06% (5)
getresourcestring - 0.06% (5)
since - 0.06% (5)
well - 0.06% (5)
seem - 0.06% (5)
backdoor.win32.denis - 0.06% (5)
apis - 0.06% (5)
fake - 0.06% (5)
want - 0.06% (5)
than - 0.06% (5)
naked - 0.06% (5)
define - 0.06% (5)
sophos - 0.06% (5)
internal - 0.06% (5)
y); - 0.06% (5)
cast - 0.06% (5)
vulnerabilities - 0.06% (5)
equals - 0.06% (5)
passed - 0.05% (4)
occur - 0.05% (4)
received - 0.05% (4)
especially - 0.05% (4)
once - 0.05% (4)
sort - 0.05% (4)
... - 0.05% (4)
every - 0.05% (4)
final - 0.05% (4)
feedsportal.com - 0.05% (4)
click - 0.05% (4)
provider - 0.05% (4)
cloud - 0.05% (4)
this. - 0.05% (4)
java - 0.05% (4)
name) - 0.05% (4)
old - 0.05% (4)
mark - 0.05% (4)
stop - 0.05% (4)
enumerated - 0.05% (4)
gettypes - 0.05% (4)
them - 0.05% (4)
environment - 0.05% (4)
analyze - 0.05% (4)
- 0.05% (4)
quality - 0.05% (4)
technology - 0.05% (4)
openid - 0.05% (4)
emby - 0.05% (4)
3.2.5 - 0.05% (4)
mediaserver - 0.05% (4)
linuxsecurity.com - 0.05% (4)
response; - 0.05% (4)
actor - 0.05% (4)
match - 0.05% (4)
encryption - 0.05% (4)
researcher - 0.05% (4)
it, - 0.05% (4)
tunnel - 0.05% (4)
objectsurrogate - 0.05% (4)
serializablemembers - 0.05% (4)
block - 0.05% (4)
sure - 0.05% (4)
expect - 0.05% (4)
deserialized - 0.05% (4)
ideal - 0.05% (4)
analysis - 0.05% (4)
world - 0.05% (4)
unknown - 0.05% (4)
traffic - 0.05% (4)
related - 0.05% (4)
vulnerable - 0.05% (4)
cim - 0.05% (4)
were - 0.05% (4)
queries - 0.05% (4)
we’d - 0.05% (4)
classes, - 0.05% (4)
bool - 0.05% (4)
means - 0.05% (4)
memorystream - 0.05% (4)
original - 0.05% (4)
objectserializedref - 0.05% (4)
type, - 0.05% (4)
returnedobject - 0.05% (4)
ones. - 0.05% (4)
comparison - 0.05% (4)
multicast - 0.05% (4)
comparison - 0.05% (4)
libraries - 0.05% (4)
next - 0.05% (4)
collection - 0.05% (4)
string, - 0.05% (4)
exploited - 0.05% (4)
protocol - 0.05% (4)
after - 0.05% (4)
lot - 0.05% (4)
default - 0.05% (4)
native - 0.05% (4)
fixed - 0.05% (4)
_type - 0.05% (4)
pretval); - 0.05% (4)
reflection - 0.05% (4)
force - 0.05% (4)
loaded - 0.05% (4)
serializable, - 0.05% (4)
server. - 0.05% (4)
much - 0.05% (4)
getserializedbuffer - 0.05% (4)
appdomain - 0.05% (4)
seems - 0.05% (4)
same - 0.05% (4)
hand - 0.05% (4)
developers - 0.05% (4)
process. - 0.05% (4)
facebook - 0.05% (4)
exploiting - 0.05% (4)
nás - 0.05% (4)
software - 0.05% (4)
execution - 0.05% (4)
project - 0.05% (4)
across - 0.05% (4)
couple - 0.05% (4)
fact - 0.05% (4)
core - 0.05% (4)
idispatch - 0.05% (4)
services. - 0.05% (4)
whistleblowers - 0.05% (4)
large - 0.05% (4)
both - 0.05% (4)
best - 0.05% (4)
vaše - 0.05% (4)
gnu/linux - 0.05% (4)
done - 0.05% (4)
step - 0.05% (4)
there’s - 0.05% (4)
already - 0.05% (4)
packet - 0.04% (3)
.net, - 0.04% (3)
text; - 0.04% (3)
trojans - 0.04% (3)
unique - 0.04% (3)
(in - 0.04% (3)
broker - 0.04% (3)
sequence - 0.04% (3)
may - 0.04% (3)
text) - 0.04% (3)
let’s - 0.04% (3)
database. - 0.04% (3)
address - 0.04% (3)
receives - 0.04% (3)
no, - 0.04% (3)
different - 0.04% (3)
must - 0.04% (3)
bug - 0.04% (3)
nonserializable - 0.04% (3)
specific - 0.04% (3)
sandbox - 0.04% (3)
_text - 0.04% (3)
set, - 0.04% (3)
packed - 0.04% (3)
running - 0.04% (3)
960 - 0.04% (3)
blogy - 0.04% (3)
complete - 0.04% (3)
activator - 0.04% (3)
wrote - 0.04% (3)
poc - 0.04% (3)
created - 0.04% (3)
poslední - 0.04% (3)
results - 0.04% (3)
highlighted - 0.04% (3)
badgers. - 0.04% (3)
comvisible(true)] - 0.04% (3)
therefore - 0.04% (3)
streamingcontext - 0.04% (3)
discuss - 0.04% (3)
(which - 0.04% (3)
- 0.04% (3)
method. - 0.04% (3)
resulted - 0.04% (3)
rebuild - 0.04% (3)
outside - 0.04% (3)
typical - 0.04% (3)
interoperability - 0.04% (3)
text, - 0.04% (3)
override - 0.04% (3)
convert - 0.04% (3)
foreach - 0.04% (3)
millions - 0.04% (3)
boilerplate - 0.04% (3)
control - 0.04% (3)
.net. - 0.04% (3)
happens - 0.04% (3)
before - 0.04% (3)
contains - 0.04% (3)
rely - 0.04% (3)
exists - 0.04% (3)
objects. - 0.04% (3)
institute - 0.04% (3)
challenge - 0.04% (3)
affect - 0.04% (3)
workflow - 0.04% (3)
namespace - 0.04% (3)
interfacetype - 0.04% (3)
iunknown - 0.04% (3)
shows - 0.04% (3)
integer - 0.04% (3)
operate - 0.04% (3)
finding - 0.04% (3)
play - 0.04% (3)
strings - 0.04% (3)
process::start - 0.04% (3)
_comparison - 0.04% (3)
dlls - 0.04% (3)
zero - 0.04% (3)
basic - 0.04% (3)
does. - 0.04% (3)
perhaps - 0.04% (3)
parameters - 0.04% (3)
apps - 0.04% (3)
object, - 0.04% (3)
realize - 0.04% (3)
insecure - 0.04% (3)
type) - 0.04% (3)
assemblies - 0.04% (3)
aktuality - 0.04% (3)
relevant - 0.04% (3)
say - 0.04% (3)
apple - 0.04% (3)
enterprise - 0.04% (3)
immediate - 0.04% (3)
signed - 0.04% (3)
id, - 0.04% (3)
victims - 0.04% (3)
serializable) - 0.04% (3)
appeared - 0.04% (3)
getobjectidentity - 0.04% (3)
weaknesses - 0.04% (3)
determine - 0.04% (3)
password - 0.04% (3)
webu - 0.04% (3)
early - 0.04% (3)
object[] - 0.04% (3)
pages - 0.04% (3)
problem - 0.04% (3)
still - 0.04% (3)
files - 0.04% (3)
[…] - 0.04% (3)
rss - 0.04% (3)
hidden - 0.04% (3)
zpravodajství - 0.04% (3)
sonarqube - 0.04% (3)
attempt - 0.04% (3)
jak - 0.04% (3)
instance, - 0.04% (3)
gdpr - 0.04% (3)
sound - 0.04% (3)
anything - 0.04% (3)
behavior - 0.04% (3)
doesn’t - 0.04% (3)
(such - 0.04% (3)
týdnů - 0.04% (3)
base_list - 0.04% (3)
tools - 0.04% (3)
again - 0.04% (3)
story - 0.04% (3)
resources. - 0.04% (3)
virové - 0.04% (3)
privileges - 0.04% (3)
researchers - 0.04% (3)
assembly) - 0.04% (3)
pointer - 0.04% (3)
exact - 0.04% (3)
secure' - 0.04% (3)
previous - 0.04% (3)
never - 0.04% (3)
multiple - 0.04% (3)
target - 0.04% (3)
2016 - 0.04% (3)
help - 0.04% (3)
topic - 0.04% (3)
'not - 0.04% (3)
kaspersky - 0.04% (3)
off - 0.04% (3)
resulting - 0.04% (3)
servers - 0.04% (3)
loading - 0.04% (3)
invoke_list - 0.04% (3)
few - 0.04% (3)
asks - 0.04% (3)
dcom. - 0.04% (3)
invocation - 0.04% (3)
feature - 0.04% (3)
command - 0.04% (3)
brief - 0.04% (3)
initial - 0.04% (3)
creation - 0.04% (3)
clear - 0.04% (3)
string.format - 0.04% (3)
threatpost - 0.04% (3)
d); - 0.04% (3)
wsman - 0.04% (3)
obvious - 0.04% (3)
cracking - 0.04% (3)
quick - 0.04% (3)
stage - 0.04% (3)
certainly - 0.04% (3)
home - 0.04% (3)
including - 0.04% (3)
bsd - 0.04% (3)
better - 0.04% (3)
chosen - 0.04% (3)
obsah - 0.04% (3)
state - 0.04% (3)
commons - 0.04% (3)
length - 0.04% (3)
talktalk - 0.02% (2)
fans - 0.02% (2)
£59m’ - 0.02% (2)
usually - 0.02% (2)
‘would - 0.02% (2)
cpu - 0.02% (2)
3.0 - 0.02% (2)
time. - 0.02% (2)
data. - 0.02% (2)
week - 0.02% (2)
values) - 0.02% (2)
key, - 0.02% (2)
immediately - 0.02% (2)
zpráva - 0.02% (2)
protocols - 0.02% (2)
inspect - 0.02% (2)
googlu - 0.02% (2)
explorer - 0.02% (2)
throw - 0.02% (2)
fail - 0.02% (2)
university - 0.02% (2)
michigan - 0.02% (2)
applications - 0.02% (2)
team - 0.02% (2)
classes. - 0.02% (2)
exploits - 0.02% (2)
hacking, - 0.02% (2)
zajímavých - 0.02% (2)
využili - 0.02% (2)
jen - 0.02% (2)
government - 0.02% (2)
actors’ - 0.02% (2)
feedsportal.com. - 0.02% (2)
shipping - 0.02% (2)
physical - 0.02% (2)
propaganda - 0.02% (2)
‘malicious - 0.02% (2)
carriers - 0.02% (2)
topics - 0.02% (2)
links - 0.02% (2)
sense - 0.02% (2)
arrive - 0.02% (2)
silicon - 0.02% (2)
implications - 0.02% (2)
bude - 0.02% (2)
příspěvky - 0.02% (2)
15:00 - 0.02% (2)
sale! - 0.02% (2)
admits - 0.02% (2)
leave - 0.02% (2)
base64 - 0.02% (2)
raspberry - 0.02% (2)
branch - 0.02% (2)
registry - 0.02% (2)
první - 0.02% (2)
creative - 0.02% (2)
fields - 0.02% (2)
empty - 0.02% (2)
dword - 0.02% (2)
část - 0.02% (2)
follows - 0.02% (2)
computer, - 0.02% (2)
obtain - 0.02% (2)
uk: - 0.02% (2)
data, - 0.02% (2)
section - 0.02% (2)
ztracené - 0.02% (2)
peníze - 0.02% (2)
begins - 0.02% (2)
depending - 0.02% (2)
(the - 0.02% (2)
attacked - 0.02% (2)
systém - 0.02% (2)
format. - 0.02% (2)
conclusion - 0.02% (2)
rare - 0.02% (2)
přihlásit - 0.02% (2)
pomocí - 0.02% (2)
přihlášení - 0.02% (2)
články - 0.02% (2)
výstavy - 0.02% (2)
youtube - 0.02% (2)
nový - 0.02% (2)
postřehy - 0.02% (2)
bezpečnosti - 0.02% (2)
super - 0.02% (2)
heslo - 0.02% (2)
sonarqube: - 0.02% (2)
filmy - 0.02% (2)
chrome - 0.02% (2)
dny - 0.02% (2)
eye - 0.02% (2)
become - 0.02% (2)
oblíbený - 0.02% (2)
irc - 0.02% (2)
linuxsecurity.com: - 0.02% (2)
literatura - 0.02% (2)
serveru - 0.02% (2)
pemcracker - 0.02% (2)
mapa - 0.02% (2)
který - 0.02% (2)
gettickcount - 0.02% (2)
recover - 0.02% (2)
user - 0.02% (2)
ransom - 0.02% (2)
leaked - 0.02% (2)
brief: - 0.02% (2)
cia’s - 0.02% (2)
months - 0.02% (2)
bother - 0.02% (2)
writers - 0.02% (2)
virus - 0.02% (2)
recent - 0.02% (2)
establish - 0.02% (2)
kashmir - 0.02% (2)
fcc - 0.02% (2)
guarantee - 0.02% (2)
neutrality - 0.02% (2)
projekty - 0.02% (2)
služby - 0.02% (2)
tunneling - 0.02% (2)
‘whaling’ - 0.02% (2)
blocks - 0.02% (2)
social - 0.02% (2)
media; - 0.02% (2)
communications - 0.02% (2)
tracking - 0.02% (2)
‘scribbles’ - 0.02% (2)
sends - 0.02% (2)
stated - 0.02% (2)
as: - 0.02% (2)
references - 0.02% (2)
body - 0.02% (2)
y3vyaw9zaxr5.example.com - 0.02% (2)
účtu? - 0.02% (2)
vašeho - 0.02% (2)
c&c. - 0.02% (2)
bankovního - 0.02% (2)
expected - 0.02% (2)
used, - 0.02% (2)
required - 0.02% (2)
sql - 0.02% (2)
approach - 0.02% (2)
risk - 0.02% (2)
reveals - 0.02% (2)
experience - 0.02% (2)
času, - 0.02% (2)
noted - 0.02% (2)
export - 0.02% (2)
vina - 0.02% (2)
(18) - 0.02% (2)
revealed; - 0.02% (2)
primitive - 0.02% (2)
modify - 0.02% (2)
implementation. - 0.02% (2)
github. - 0.02% (2)
tries - 0.02% (2)
screenshot - 0.02% (2)
second - 0.02% (2)
escape - 0.02% (2)
process.start - 0.02% (2)
that’s - 0.02% (2)
called - 0.02% (2)
iwbemservices - 0.02% (2)
class, - 0.02% (2)
capture - 0.02% (2)
acting - 0.02% (2)
requires - 0.02% (2)
creates - 0.02% (2)
added - 0.02% (2)
considering - 0.02% (2)
beginning - 0.02% (2)
namespace. - 0.02% (2)
performance - 0.02% (2)
communication, - 0.02% (2)
quite - 0.02% (2)
wireshark - 0.02% (2)
rpc - 0.02% (2)
additional - 0.02% (2)
why - 0.02% (2)
iserializable - 0.02% (2)
context) - 0.02% (2)
dynamically - 0.02% (2)
either - 0.02% (2)
sadly - 0.02% (2)
objects, - 0.02% (2)
desired - 0.02% (2)
generated - 0.02% (2)
together - 0.02% (2)
along - 0.02% (2)
wrapper - 0.02% (2)
callable - 0.02% (2)
system.object - 0.02% (2)
tend - 0.02% (2)
situation - 0.02% (2)
executes - 0.02% (2)
started - 0.02% (2)
escalation - 0.02% (2)
dfsvc - 0.02% (2)
exactly - 0.02% (2)
monitor - 0.02% (2)
*pretval); - 0.02% (2)
probably - 0.02% (2)
rules - 0.02% (2)
clickonce - 0.02% (2)
slightly - 0.02% (2)
deployment - 0.02% (2)
made - 0.02% (2)
wouldn’t - 0.02% (2)
system.management - 0.02% (2)
compromised - 0.02% (2)
generically - 0.02% (2)
cve-2014-4073 - 0.02% (2)
dangerous - 0.02% (2)
java, - 0.02% (2)
usa - 0.02% (2)
allows - 0.02% (2)
day, - 0.02% (2)
can’t - 0.02% (2)
big - 0.02% (2)
package - 0.02% (2)
presence - 0.02% (2)
server, - 0.02% (2)
minutes - 0.02% (2)
presentation - 0.02% (2)
specified - 0.02% (2)
server’s - 0.02% (2)
needs - 0.02% (2)
ihashcodeprovider - 0.02% (2)
checks - 0.02% (2)
trick - 0.02% (2)
purpose - 0.02% (2)
adding - 0.02% (2)
automatic - 0.02% (2)
us. - 0.02% (2)
client. - 0.02% (2)
exploit, - 0.02% (2)
keys - 0.02% (2)
lookup - 0.02% (2)
here. - 0.02% (2)
domain. - 0.02% (2)
scan - 0.02% (2)
reasons - 0.02% (2)
double - 0.02% (2)
“unwrap” - 0.02% (2)
machines - 0.02% (2)
behavior. - 0.02% (2)
marshals - 0.02% (2)
implements - 0.02% (2)
possible - 0.02% (2)
.net) - 0.02% (2)
powershell - 0.02% (2)
versions - 0.02% (2)
int* - 0.02% (2)
per-runtime - 0.02% (2)
attacking - 0.02% (2)
mind - 0.02% (2)
dolby - 0.02% (2)
current - 0.02% (2)
matches - 0.02% (2)
similar - 0.02% (2)
modern - 0.02% (2)
thought - 0.02% (2)
rcw. - 0.02% (2)
documented - 0.02% (2)
appropriate - 0.02% (2)
well. - 0.02% (2)
adds - 0.02% (2)
getsurrogate(type - 0.02% (2)
context, - 0.02% (2)
iserializationsurrogate - 0.02% (2)
designed - 0.02% (2)
_text; - 0.02% (2)
mysurrogateselector - 0.02% (2)
selector) - 0.02% (2)
hello - 0.02% (2)
going - 0.02% (2)
exposing - 0.02% (2)
untrusted - 0.02% (2)
hope - 0.02% (2)
piece - 0.02% (2)
non-serializable - 0.02% (2)
handle - 0.02% (2)
functional - 0.02% (2)
chain. - 0.02% (2)
because - 0.02% (2)
typically - 0.02% (2)
lead - 0.02% (2)
ideserializationcallback - 0.02% (2)
returnedobject; - 0.02% (2)
spying - 0.02% (2)
replace - 0.02% (2)
your - 0.02% (2)
string[] - 0.02% (2)
interesting - 0.02% (2)
doing - 0.02% (2)
against - 0.02% (2)
(linq - 0.02% (2)
smartphones. - 0.02% (2)
says - 0.02% (2)
nothing - 0.02% (2)
computers - 0.02% (2)
within - 0.02% (2)
option - 0.02% (2)
work. - 0.02% (2)
get_types_del - 0.02% (2)
(func - 0.02% (2)
list - 0.02% (2)
potentially - 0.02% (2)
hackers - 0.02% (2)
normal - 0.02% (2)
item - 0.02% (2)
published - 0.02% (2)
3.5 - 0.02% (2)
pick - 0.02% (2)
i’ll - 0.02% (2)
vault - 0.02% (2)
according - 0.02% (2)
documents - 0.02% (2)
name.length - 0.02% (2)
orderby - 0.02% (2)
ienumerable - 0.02% (2)
based - 0.02% (2)
lists - 0.02% (2)
sounds - 0.02% (2)
technology, - 0.02% (2)
comparisoncomparer - 0.02% (2)
compatible - 0.02% (2)
[serializable] - 0.02% (2)
implementing - 0.02% (2)
icustominterface - 0.02% (2)
[comvisible(true)] - 0.02% (2)
queryinterface - 0.02% (2)
comparison; - 0.02% (2)
comparer::create - 0.02% (2)
chain, - 0.02% (2)
icomparer - 0.02% (2)
integer, - 0.02% (2)
takes - 0.02% (2)
comobject - 0.02% (2)
around - 0.02% (2)
findserializabletypes - 0.02% (2)
string: - 0.02% (2)
operation - 0.02% (2)
gacutil - 0.02% (2)
specify - 0.02% (2)
amount - 0.02% (2)
assembly_name) - 0.02% (2)
registrationservices - 0.02% (2)
dosomething() - 0.02% (2)
clsid - 0.02% (2)
attribute - 0.02% (2)
asm - 0.02% (2)
ensuring - 0.02% (2)
abuse - 0.02% (2)
entry - 0.02% (2)
model - 0.02% (2)
weird - 0.02% (2)
deserialize. - 0.02% (2)
distributed - 0.02% (2)
separate - 0.02% (2)
methods. - 0.02% (2)
nicer - 0.02% (2)
update - 0.02% (2)
difficult - 0.02% (2)
makes - 0.02% (2)
component - 0.02% (2)
stm.position - 0.02% (2)
fmt.serialize(stm, - 0.02% (2)
placing - 0.02% (2)
short - 0.02% (2)
fieldinfo - 0.02% (2)
comp) - 0.02% (2)
focus - 0.02% (2)
lesson - 0.02% (2)
sortedset - 0.02% (2)
binaryformatter(); - 0.02% (2)
memorystream(); - 0.02% (2)
history - 0.02% (2)
serialization. - 0.02% (2)
dummy - 0.02% (2)
ienumerable>) - 0.02% (2)
of the - 0.67% (55)
in the - 0.5% (41)
to the - 0.4% (33)
at the - 0.33% (27)
on the - 0.27% (22)
2017 - - 0.24% (20)
the com - 0.24% (20)
duben, 2017 - 0.24% (20)
hacking & - 0.24% (20)
& security - 0.24% (20)
kategorie: hacking - 0.24% (20)
28 duben, - 0.22% (18)
com object - 0.22% (18)
this is - 0.21% (17)
the server - 0.2% (16)
we can - 0.2% (16)
that the - 0.17% (14)
the .net - 0.17% (14)
in .net - 0.17% (14)
and the - 0.17% (14)
such a - 0.16% (13)
the following - 0.16% (13)
you can - 0.15% (12)
would be - 0.15% (12)
which is - 0.15% (12)
such as - 0.13% (11)
have a - 0.13% (11)
the delegate - 0.13% (11)
as the - 0.12% (10)
from the - 0.12% (10)
with the - 0.12% (10)
is the - 0.11% (9)
the c&c - 0.11% (9)
part of - 0.11% (9)
for the - 0.11% (9)
the client - 0.11% (9)
the runtime - 0.11% (9)
an arbitrary - 0.1% (8)
a list - 0.1% (8)
list of - 0.1% (8)
the object - 0.1% (8)
.net object - 0.1% (8)
using the - 0.1% (8)
object to - 0.1% (8)
com server - 0.09% (7)
by the - 0.09% (7)
if you - 0.09% (7)
the ccw - 0.09% (7)
in this - 0.09% (7)
to use - 0.09% (7)
the first - 0.09% (7)
back to - 0.09% (7)
try and - 0.09% (7)
but the - 0.09% (7)
type t - 0.09% (7)
with a - 0.09% (7)
the data - 0.09% (7)
security - - 0.07% (6)
create a - 0.07% (6)
class which - 0.07% (6)
security, viry - 0.07% (6)
{ return - 0.07% (6)
the following: - 0.07% (6)
a červi - 0.07% (6)
was in - 0.07% (6)
& security, - 0.07% (6)
able to - 0.07% (6)
if the - 0.07% (6)
the bot - 0.07% (6)
viry a - 0.07% (6)
object is - 0.07% (6)
it will - 0.07% (6)
sent to - 0.06% (5)
which are - 0.06% (5)
implemented in - 0.06% (5)
looking at - 0.06% (5)
the list - 0.06% (5)
naked security - 0.06% (5)
.net com - 0.06% (5)
returns a - 0.06% (5)
an instance - 0.06% (5)
that a - 0.06% (5)
use the - 0.06% (5)
find the - 0.06% (5)
thing to - 0.06% (5)
what i - 0.06% (5)
and return - 0.06% (5)
and in - 0.06% (5)
which will - 0.06% (5)
a delegate - 0.06% (5)
out that - 0.06% (5)
can be - 0.06% (5)
need to - 0.06% (5)
we need - 0.06% (5)
classes which - 0.06% (5)
like the - 0.06% (5)
interfaces a - 0.06% (5)
a class - 0.06% (5)
which when - 0.06% (5)
written in - 0.06% (5)
the implementation - 0.06% (5)
instance of - 0.06% (5)
sophos naked - 0.06% (5)
code for - 0.06% (5)
use of - 0.06% (5)
do the - 0.05% (4)
about the - 0.05% (4)
it’s a - 0.05% (4)
you could - 0.05% (4)
series of - 0.05% (4)
introduced in - 0.05% (4)
likely to - 0.05% (4)
as this - 0.05% (4)
look at - 0.05% (4)
but in - 0.05% (4)
inside the - 0.05% (4)
from a - 0.05% (4)
couple of - 0.05% (4)
_object interface - 0.05% (4)
looks like - 0.05% (4)
instead of - 0.05% (4)
to try - 0.05% (4)
it would - 0.05% (4)
use case - 0.05% (4)
is serializable - 0.05% (4)
access to - 0.05% (4)
like a - 0.05% (4)
is implemented - 0.05% (4)
there are - 0.05% (4)
the security - 0.05% (4)
could have - 0.05% (4)
the only - 0.05% (4)
the result - 0.05% (4)
used a - 0.05% (4)
to track - 0.05% (4)
this work - 0.05% (4)
emby mediaserver - 0.05% (4)
an rcw - 0.05% (4)
one of - 0.05% (4)
the same - 0.05% (4)
size of - 0.05% (4)
the process - 0.05% (4)
easy to - 0.05% (4)
delegate to - 0.05% (4)
imanagedobject is - 0.05% (4)
the trojan - 0.05% (4)
a couple - 0.05% (4)
the dns - 0.05% (4)
delegate which - 0.05% (4)
the domain - 0.05% (4)
an ideal - 0.04% (3)
are not - 0.04% (3)
can find - 0.04% (3)
find a - 0.04% (3)
and have - 0.04% (3)
write some - 0.04% (3)
a pretty - 0.04% (3)
arbitrary code - 0.04% (3)
static void - 0.04% (3)
the network - 0.04% (3)
blog post - 0.04% (3)
in native - 0.04% (3)
it turns - 0.04% (3)
installed a - 0.04% (3)
code execution - 0.04% (3)
less than - 0.04% (3)
for any - 0.04% (3)
tool to - 0.04% (3)
implementation of - 0.04% (3)
hacker news - 0.04% (3)
the hashtable - 0.04% (3)
is serializable, - 0.04% (3)
native code - 0.04% (3)
dcom object - 0.04% (3)
connect to - 0.04% (3)
the query - 0.04% (3)
we’ll need - 0.04% (3)
but instead - 0.04% (3)
the deserialization - 0.04% (3)
over the - 0.04% (3)
wmi client - 0.04% (3)
almost certainly - 0.04% (3)
the dc - 0.04% (3)
since the - 0.04% (3)
support for - 0.04% (3)
for wmi - 0.04% (3)
for imanagedobject - 0.04% (3)
a client - 0.04% (3)
need a - 0.04% (3)
process object - 0.04% (3)
communication with - 0.04% (3)
resources. kategorie: - 0.04% (3)
is sent - 0.04% (3)
malicious program - 0.04% (3)
it does - 0.04% (3)
it should - 0.04% (3)
on infosec - 0.04% (3)
appeared first - 0.04% (3)
a cloud - 0.04% (3)
code in - 0.04% (3)
infosec institute - 0.04% (3)
resources - - 0.04% (3)
[…] the - 0.04% (3)
some of - 0.04% (3)
when a - 0.04% (3)
first on - 0.04% (3)
the post - 0.04% (3)
infosec resources. - 0.04% (3)
known as - 0.04% (3)
facebook a - 0.04% (3)
for more - 0.04% (3)
security weaknesses - 0.04% (3)
institute resources - 0.04% (3)
the instruction - 0.04% (3)
the request - 0.04% (3)
c&c instructions - 0.04% (3)
a very - 0.04% (3)
'not secure' - 0.04% (3)
results in - 0.04% (3)
resource string - 0.04% (3)
class. this - 0.04% (3)
this case - 0.04% (3)
return the - 0.04% (3)
which would - 0.04% (3)
used as - 0.04% (3)
not just - 0.04% (3)
the return - 0.04% (3)
a long - 0.04% (3)
this class - 0.04% (3)
{ private - 0.04% (3)
returns an - 0.04% (3)
the class - 0.04% (3)
comparer object - 0.04% (3)
an object - 0.04% (3)
the original - 0.04% (3)
get the - 0.04% (3)
enumerable list - 0.04% (3)
all the - 0.04% (3)
collection classes - 0.04% (3)
passed to - 0.04% (3)
an open - 0.04% (3)
and returns - 0.04% (3)
the developer - 0.04% (3)
a test - 0.04% (3)
the api - 0.04% (3)
millions of - 0.04% (3)
you do - 0.04% (3)
in its - 0.04% (3)
} static - 0.04% (3)
to call - 0.04% (3)
object which - 0.04% (3)
be nice - 0.04% (3)
might not - 0.04% (3)
have chosen - 0.04% (3)
reflection apis - 0.04% (3)
a security - 0.04% (3)
if this - 0.04% (3)
the imanagedobject - 0.04% (3)
of its - 0.04% (3)
appdomain id - 0.04% (3)
managed object - 0.04% (3)
the hacker - 0.04% (3)
news - - 0.04% (3)
to determine - 0.04% (3)
when the - 0.04% (3)
as part - 0.04% (3)
method which - 0.04% (3)
resulted in - 0.04% (3)
com client - 0.04% (3)
.net runtime - 0.04% (3)
whether the - 0.04% (3)
in fact - 0.04% (3)
well as - 0.04% (3)
{ public - 0.04% (3)
com class - 0.04% (3)
with com - 0.04% (3)
com interface - 0.04% (3)
number of - 0.04% (3)
to make - 0.04% (3)
in .net, - 0.04% (3)
: public - 0.04% (3)
the other - 0.04% (3)
version of - 0.04% (3)
a large - 0.04% (3)
the _object - 0.04% (3)
apps that - 0.04% (3)
this method - 0.04% (3)
object and - 0.04% (3)
(such as - 0.04% (3)
for sale! - 0.02% (2)
15:00 click - 0.02% (2)
may be - 0.02% (2)
this domain - 0.02% (2)
feedsportal.com - - 0.02% (2)
here for - 0.02% (2)
more information - 0.02% (2)
on all - 0.02% (2)
and most - 0.02% (2)
best information - 0.02% (2)
threatpost - - 0.02% (2)
relevant links - 0.02% (2)
vaše vina - 0.02% (2)
and as - 0.02% (2)
a better - 0.02% (2)
the presence - 0.02% (2)
it seems - 0.02% (2)
all .net - 0.02% (2)
makes it - 0.02% (2)
admits it - 0.02% (2)
insecure apps - 0.02% (2)
topics related - 0.02% (2)
by ‘malicious - 0.02% (2)
propaganda tool - 0.02% (2)
is being - 0.02% (2)
účtu? no, - 0.02% (2)
to feedsportal.com. - 0.02% (2)
as they - 0.02% (2)
net neutrality - 0.02% (2)
what interfaces - 0.02% (2)
an example - 0.02% (2)
pass a - 0.02% (2)
tunneling for - 0.02% (2)
callable wrapper - 0.02% (2)
has come - 0.02% (2)
way since - 0.02% (2)
more than - 0.02% (2)
all that - 0.02% (2)
of malware - 0.02% (2)
along with - 0.02% (2)
for instance, - 0.02% (2)
carriers to - 0.02% (2)
and from - 0.02% (2)
physical data - 0.02% (2)
shipping of - 0.02% (2)
to stop - 0.02% (2)
equals method - 0.02% (2)
service provider - 0.02% (2)
is likely - 0.02% (2)
data. if - 0.02% (2)
interface is - 0.02% (2)
the server’s - 0.02% (2)
should be - 0.02% (2)
rcw for - 0.02% (2)
i exploited - 0.02% (2)
of type - 0.02% (2)
look in - 0.02% (2)
the types - 0.02% (2)
so instead - 0.02% (2)
the default - 0.02% (2)
the assembly - 0.02% (2)
clickonce deployment - 0.02% (2)
ports leave - 0.02% (2)
this by - 0.02% (2)
result in - 0.02% (2)
delegate object, - 0.02% (2)
.net 4. - 0.02% (2)
but that - 0.02% (2)
query syntax - 0.02% (2)
* pretval); - 0.02% (2)
query = - 0.02% (2)
to perform - 0.02% (2)
was introduced - 0.02% (2)
deployment broker - 0.02% (2)
the previous - 0.02% (2)
a type - 0.02% (2)
to get - 0.02% (2)
byte array - 0.02% (2)
list to - 0.02% (2)
ienumerable query - 0.02% (2)
open delegate - 0.02% (2)
with our - 0.02% (2)
implementation is - 0.02% (2)
the values - 0.02% (2)
resulting in - 0.02% (2)
serialization for - 0.02% (2)
go back - 0.02% (2)
is how - 0.02% (2)
tostring on - 0.02% (2)
as it’s - 0.02% (2)
looking for - 0.02% (2)
from memory - 0.02% (2)
chain of - 0.02% (2)
at this - 0.02% (2)
this. in - 0.02% (2)
a method - 0.02% (2)
we get - 0.02% (2)
that open - 0.02% (2)
how do - 0.02% (2)
internet explorer - 0.02% (2)
to gain - 0.02% (2)
when i - 0.02% (2)
bit of - 0.02% (2)
already have - 0.02% (2)
arbitrary object - 0.02% (2)
classes. the - 0.02% (2)
analysis tools - 0.02% (2)
any other - 0.02% (2)
that can - 0.02% (2)
pages as - 0.02% (2)
com visible - 0.02% (2)
all http - 0.02% (2)
linuxsecurity.com - - 0.02% (2)
konference a - 0.02% (2)
tool for - 0.02% (2)
cracking pem - 0.02% (2)
security new - 0.02% (2)
and its - 0.02% (2)
recover the - 0.02% (2)
attempt to - 0.02% (2)
the purpose - 0.02% (2)
method is - 0.02% (2)
in some - 0.02% (2)
section highlighted - 0.02% (2)
c&c response; - 0.02% (2)
as follows - 0.02% (2)
environment is - 0.02% (2)
instruction is - 0.02% (2)
of data - 0.02% (2)
after the - 0.02% (2)
used by - 0.02% (2)
hacking the - 0.02% (2)
sequence of - 0.02% (2)
empty queries - 0.02% (2)
in .net. - 0.02% (2)
used to - 0.02% (2)
weaknesses of - 0.02% (2)
5 dnů - 0.02% (2)
před 1 - 0.02% (2)
týdnů 1 - 0.02% (2)
přihlásit pomocí - 0.02% (2)
a hidden - 0.02% (2)
creative commons - 0.02% (2)
void dosomething() - 0.02% (2)
home články - 0.02% (2)
icustominterface { - 0.02% (2)
a number - 0.02% (2)
security vulnerabilities - 0.02% (2)
raspberry pi - 0.02% (2)
is really - 0.02% (2)
in java - 0.02% (2)
queryinterface on - 0.02% (2)
define com - 0.02% (2)
.net to - 0.02% (2)
come a - 0.02% (2)
so simple - 0.02% (2)
sonarqube: a - 0.02% (2)
hidden gem - 0.02% (2)
is written - 0.02% (2)
university of - 0.02% (2)
quality of - 0.02% (2)
means that - 0.02% (2)
into the - 0.02% (2)
info about - 0.02% (2)
from every - 0.02% (2)
it’s not - 0.02% (2)
must be - 0.02% (2)
for it - 0.02% (2)
be noted - 0.02% (2)
names of - 0.02% (2)
format it - 0.02% (2)
don’t realize - 0.02% (2)
dns server - 0.02% (2)
references to - 0.02% (2)
the functions - 0.02% (2)
is that - 0.02% (2)
not be - 0.02% (2)
is encrypted - 0.02% (2)
it news - 0.02% (2)
comes in - 0.02% (2)
case of - 0.02% (2)
or even - 0.02% (2)
*pretval); hresult - 0.02% (2)
vašeho bankovního - 0.02% (2)
adds a - 0.02% (2)
list. the - 0.02% (2)
peníze z - 0.02% (2)
the names - 0.02% (2)
is what - 0.02% (2)
this trojan - 0.02% (2)
dns request - 0.02% (2)
request to - 0.02% (2)
the section - 0.02% (2)
the data, - 0.02% (2)
sent in - 0.02% (2)
large amount - 0.02% (2)
start of - 0.02% (2)
packed using - 0.02% (2)
výstavy virové - 0.02% (2)
and create - 0.02% (2)
file system - 0.02% (2)
the packet - 0.02% (2)
unique id - 0.02% (2)
that comes - 0.02% (2)
id and - 0.02% (2)
zpravodajství hacking - 0.02% (2)
could also - 0.02% (2)
server receives - 0.02% (2)
a request - 0.02% (2)
how this - 0.02% (2)
but for - 0.02% (2)
call getobjectidentity - 0.02% (2)
uk: ztracené - 0.02% (2)
filmy literatura - 0.02% (2)
text of - 0.02% (2)
request is - 0.02% (2)
it can - 0.02% (2)
ensuring that - 0.02% (2)
smartphones at - 0.02% (2)
fake implementation. - 0.02% (2)
start the - 0.02% (2)
the registration - 0.02% (2)
this would - 0.02% (2)
is exposed - 0.02% (2)
využili času, - 0.02% (2)
our fake - 0.02% (2)
it just - 0.02% (2)
get it - 0.02% (2)
by calling - 0.02% (2)
to vaše - 0.02% (2)
wmi object. - 0.02% (2)
in order - 0.02% (2)
managed dcom - 0.02% (2)
runtime will - 0.02% (2)
ccw and - 0.02% (2)
with windows - 0.02% (2)
one with - 0.02% (2)
wmi server. - 0.02% (2)
client i - 0.02% (2)
vault 7 - 0.02% (2)
can see - 0.02% (2)
a process - 0.02% (2)
which we - 0.02% (2)
the initial - 0.02% (2)
facebook admits - 0.02% (2)
code to - 0.02% (2)
look for - 0.02% (2)
the managed - 0.02% (2)
i know - 0.02% (2)
object from - 0.02% (2)
victims revealed; - 0.02% (2)
and get - 0.02% (2)
instead we’ll - 0.02% (2)
the university - 0.02% (2)
media; ‘whaling’ - 0.02% (2)
up with - 0.02% (2)
remote code - 0.02% (2)
this situation - 0.02% (2)
object, which - 0.02% (2)
talktalk gdpr - 0.02% (2)
running the - 0.02% (2)
exploiting .net - 0.02% (2)
be £59m’ - 0.02% (2)
exactly what - 0.02% (2)
streamingcontext context) - 0.02% (2)
public void - 0.02% (2)
object. this - 0.02% (2)
then we - 0.02% (2)
network to - 0.02% (2)
back a - 0.02% (2)
fine ‘would - 0.02% (2)
we also - 0.02% (2)
the dcom - 0.02% (2)
interface. if - 0.02% (2)
ztracené peníze - 0.02% (2)
extract a - 0.02% (2)
pointer to - 0.02% (2)
presence of - 0.02% (2)
it was - 0.02% (2)
no, je - 0.02% (2)
‘malicious actors’ - 0.02% (2)
it’s only - 0.02% (2)
can force - 0.02% (2)
tool by - 0.02% (2)
the service - 0.02% (2)
id matches - 0.02% (2)
i discovered - 0.02% (2)
z vašeho - 0.02% (2)
they didn’t - 0.02% (2)
apis to - 0.02% (2)
to deserialize - 0.02% (2)
will be - 0.02% (2)
of michigan - 0.02% (2)
class exists - 0.02% (2)
to this - 0.02% (2)
com service - 0.02% (2)
wrote a - 0.02% (2)
object instance - 0.02% (2)
bankovního účtu? - 0.02% (2)
according to - 0.02% (2)
any .net - 0.02% (2)
calls a - 0.02% (2)
the system.management - 0.02% (2)
namespace. this - 0.02% (2)
wmi through - 0.02% (2)
.net supports - 0.02% (2)
as propaganda - 0.02% (2)
getobjectidentity on - 0.02% (2)
beginning of - 0.02% (2)
set of - 0.02% (2)
this point - 0.02% (2)
windows 8 - 0.02% (2)
being used - 0.02% (2)
return an - 0.02% (2)
if they - 0.02% (2)
.net itself - 0.02% (2)
case for - 0.02% (2)
versions of - 0.02% (2)
the per-runtime - 0.02% (2)
a similar - 0.02% (2)
at runtime - 0.02% (2)
start a - 0.02% (2)
supports a - 0.02% (2)
the interface. - 0.02% (2)
for this - 0.02% (2)
to scan - 0.02% (2)
one use - 0.02% (2)
blocks social - 0.02% (2)
didn’t do - 0.02% (2)
serializable i - 0.02% (2)
in windows - 0.02% (2)
tool ‘scribbles’ - 0.02% (2)
which resulted - 0.02% (2)
code from - 0.02% (2)
deserialize any - 0.02% (2)
of methods - 0.02% (2)
a chain - 0.02% (2)
through the - 0.02% (2)
private object - 0.02% (2)
deserialization chain. - 0.02% (2)
was the - 0.02% (2)
windows 7 - 0.02% (2)
a serialized - 0.02% (2)
end up - 0.02% (2)
which looks - 0.02% (2)
something which - 0.02% (2)
the poc - 0.02% (2)
then return - 0.02% (2)
it has - 0.02% (2)
than ideal - 0.02% (2)
to load - 0.02% (2)
our code - 0.02% (2)
process is - 0.02% (2)
return value - 0.02% (2)
call to - 0.02% (2)
a feature - 0.02% (2)
the serialization - 0.02% (2)
to work - 0.02% (2)
well. this - 0.02% (2)
the objectsurrogate - 0.02% (2)
stm.position = - 0.02% (2)
new memorystream(); - 0.02% (2)
hope of - 0.02% (2)
going to - 0.02% (2)
classes, but - 0.02% (2)
this blog - 0.02% (2)
to build - 0.02% (2)
a target - 0.02% (2)
this was - 0.02% (2)
binaryformatter(); memorystream - 0.02% (2)
binaryformatter fmt - 0.02% (2)
serialization of - 0.02% (2)
a specific - 0.02% (2)
class in - 0.02% (2)
be used - 0.02% (2)
could call - 0.02% (2)
you to - 0.02% (2)
ccw value - 0.02% (2)
risk of - 0.02% (2)
selector = - 0.02% (2)
serialization surrogate - 0.02% (2)
reveals cia - 0.02% (2)
when deserialized - 0.02% (2)
github. microsoft - 0.02% (2)
// custom - 0.02% (2)
cia’s tool - 0.02% (2)
interface. [comvisible(true)] - 0.02% (2)
assembly name - 0.02% (2)
for each - 0.02% (2)
object it - 0.02% (2)
(type type - 0.02% (2)
what the - 0.02% (2)
needs to - 0.02% (2)
affect any - 0.02% (2)
not even - 0.02% (2)
rebuild its - 0.02% (2)
a runtime - 0.02% (2)
is actually - 0.02% (2)
know of - 0.02% (2)
news in - 0.02% (2)
of assemblies - 0.02% (2)
brief: kashmir - 0.02% (2)
also need - 0.02% (2)
by wikileaks - 0.02% (2)
to create - 0.02% (2)
execute arbitrary - 0.02% (2)
project zero - 0.02% (2)
are serializable - 0.02% (2)
whistleblowers leaked - 0.02% (2)
} public - 0.02% (2)
microsoft could - 0.02% (2)
for document - 0.02% (2)
// create - 0.02% (2)
modify the - 0.02% (2)
fieldinfo fi - 0.02% (2)
to check - 0.02% (2)
new binaryformatter(); - 0.02% (2)
memorystream stm - 0.02% (2)
feature of - 0.02% (2)
object exposed - 0.02% (2)
.net interop - 0.02% (2)
outside of - 0.02% (2)
quite a - 0.02% (2)
set, which - 0.02% (2)
the sort - 0.02% (2)
a developer - 0.02% (2)
the chain, - 0.02% (2)
to implement - 0.02% (2)
custom deserialization - 0.02% (2)
which takes - 0.02% (2)
class and - 0.02% (2)
the next - 0.02% (2)
case we - 0.02% (2)
many of - 0.02% (2)
lot of - 0.02% (2)
com and - 0.02% (2)
server which - 0.02% (2)
hacking & security - 0.24% (20)
duben, 2017 - - 0.24% (20)
kategorie: hacking & - 0.24% (20)
28 duben, 2017 - 0.22% (18)
- 28 duben, - 0.22% (18)
part of the - 0.09% (7)
& security, viry - 0.07% (6)
to the c&c - 0.07% (6)
security, viry a - 0.07% (6)
viry a červi - 0.07% (6)
hacking & security, - 0.07% (6)
back to the - 0.06% (5)
naked security - - 0.06% (5)
sophos naked security - 0.06% (5)
sent to the - 0.06% (5)
this is a - 0.06% (5)
a list of - 0.06% (5)
a com object - 0.06% (5)
be able to - 0.05% (4)
written in .net - 0.05% (4)
one of the - 0.05% (4)
to the com - 0.05% (4)
a couple of - 0.05% (4)
to try and - 0.05% (4)
to track whistleblowers - 0.05% (4)
the .net object - 0.04% (3)
instance of the - 0.04% (3)
the _object interface - 0.04% (3)
infosec institute resources - 0.04% (3)
.net com object - 0.04% (3)
the .net runtime - 0.04% (3)
the delegate object - 0.04% (3)
you can find - 0.04% (3)
classes which are - 0.04% (3)
to use the - 0.04% (3)
introduced in .net - 0.04% (3)
have chosen to - 0.04% (3)
in this case - 0.04% (3)
a class which - 0.04% (3)
to the client - 0.04% (3)
the wmi client - 0.04% (3)
as well as - 0.04% (3)
like the following: - 0.04% (3)
would be nice - 0.04% (3)
likely to be - 0.04% (3)
of the .net - 0.04% (3)
out that the - 0.04% (3)
a delegate which - 0.04% (3)
of the com - 0.04% (3)
looks like the - 0.04% (3)
the security weaknesses - 0.04% (3)
as part of - 0.04% (3)
the hacker news - 0.04% (3)
vulnerability emby mediaserver - 0.04% (3)
institute resources - - 0.04% (3)
[…] the post - 0.04% (3)
some of the - 0.04% (3)
request sent to - 0.04% (3)
first on infosec - 0.04% (3)
hacker news - - 0.04% (3)
resources. kategorie: hacking - 0.04% (3)
of the function - 0.04% (3)
exactly what we - 0.02% (2)
cracking pem files - 0.02% (2)
pages as 'not - 0.02% (2)
http pages as - 0.02% (2)
we can get - 0.02% (2)
an open delegate - 0.02% (2)
an rcw for - 0.02% (2)
the file system - 0.02% (2)
the beginning of - 0.02% (2)
size of the - 0.02% (2)
information about the - 0.02% (2)
the section highlighted - 0.02% (2)
at the implementation - 0.02% (2)
so instead we’ll - 0.02% (2)
the use of - 0.02% (2)
to an instance - 0.02% (2)
týdnů 1 den - 0.02% (2)
a hidden gem - 0.02% (2)
if you do - 0.02% (2)
} } static - 0.02% (2)
konference a výstavy - 0.02% (2)
which are serializable - 0.02% (2)
virové zpravodajství hacking - 0.02% (2)
long way since - 0.02% (2)
ienumerable query = - 0.02% (2)
for cracking pem - 0.02% (2)
is to use - 0.02% (2)
in .net 4. - 0.02% (2)
security feedsportal.com - - 0.02% (2)
out in the - 0.02% (2)
can force the - 0.02% (2)
will execute arbitrary - 0.02% (2)
linuxsecurity.com - 28 - 0.02% (2)
click here for - 0.02% (2)
on all topics - 0.02% (2)
related to feedsportal.com. - 0.02% (2)
communication with the - 0.02% (2)
most relevant links - 0.02% (2)
best information and - 0.02% (2)
of the functions - 0.02% (2)
here for more - 0.02% (2)
information find the - 0.02% (2)
shipping of physical - 0.02% (2)
is sent in - 0.02% (2)
is likely to - 0.02% (2)
of physical data - 0.02% (2)
carriers to and - 0.02% (2)
cloud service provider - 0.02% (2)
and from a - 0.02% (2)
data carriers to - 0.02% (2)
way since the - 0.02% (2)
- 15:00 click - 0.02% (2)
may be for - 0.02% (2)
more information find - 0.02% (2)
dns server receives - 0.02% (2)
the best information - 0.02% (2)
text of the - 0.02% (2)
from a cloud - 0.02% (2)
be for sale! - 0.02% (2)
2017 - 15:00 - 0.02% (2)
and most relevant - 0.02% (2)
links on all - 0.02% (2)
& security feedsportal.com - 0.02% (2)
it needs to - 0.02% (2)
- this domain - 0.02% (2)
be noted that - 0.02% (2)
to the domain - 0.02% (2)
topics related to - 0.02% (2)
feedsportal.com. kategorie: hacking - 0.02% (2)
this domain may - 0.02% (2)
look for an - 0.02% (2)
29 duben, 2017 - 0.02% (2)
the university of - 0.02% (2)
reveals cia tool - 0.02% (2)
‘scribbles’ for document - 0.02% (2)
smartphones at risk - 0.02% (2)
leave millions of - 0.02% (2)
ztracené peníze z - 0.02% (2)
vašeho bankovního účtu? - 0.02% (2)
no, je to - 0.02% (2)
that open ports - 0.02% (2)
for cia’s tool - 0.02% (2)
leaked by wikileaks - 0.02% (2)
com class with - 0.02% (2)
the com interface - 0.02% (2)
what interfaces are - 0.02% (2)
it must be - 0.02% (2)
// define com - 0.02% (2)
object to a - 0.02% (2)
exploiting .net managed - 0.02% (2)
class in the - 0.02% (2)
remote code execution - 0.02% (2)
to make a - 0.02% (2)
by ‘malicious actors’ - 0.02% (2)
as propaganda tool - 0.02% (2)
ports leave millions - 0.02% (2)
of smartphones at - 0.02% (2)
risk of hacking - 0.02% (2)
wikileaks reveals cia - 0.02% (2)
apps that open - 0.02% (2)
je to vaše - 0.02% (2)
výstavy virové zpravodajství - 0.02% (2)
hacking filmy literatura - 0.02% (2)
peníze z vašeho - 0.02% (2)
bankovního účtu? no, - 0.02% (2)
tool ‘scribbles’ for - 0.02% (2)
code for cia’s - 0.02% (2)
gdpr fine ‘would - 0.02% (2)
.net managed dcom - 0.02% (2)
facebook admits it - 0.02% (2)
is being used - 0.02% (2)
victims revealed; talktalk - 0.02% (2)
social media; ‘whaling’ - 0.02% (2)
tool to track - 0.02% (2)
whistleblowers leaked by - 0.02% (2)
brief: kashmir blocks - 0.02% (2)
clickonce deployment broker - 0.02% (2)
be used to - 0.02% (2)
shows what i - 0.02% (2)
we need to - 0.02% (2)
využili času, který - 0.02% (2)
{ public void - 0.02% (2)
support for wmi - 0.02% (2)
is implemented in - 0.02% (2)
the server itself - 0.02% (2)
we can force - 0.02% (2)
the server to - 0.02% (2)
one use case - 0.02% (2)
we also need - 0.02% (2)
to find a - 0.02% (2)
stm = new - 0.02% (2)
stm.position = 0; - 0.02% (2)
which returns an - 0.02% (2)
of the process - 0.02% (2)
new binaryformatter(); memorystream - 0.02% (2)
binaryformatter fmt = - 0.02% (2)
classes which when - 0.02% (2)
list of assemblies - 0.02% (2)
} public override - 0.02% (2)
can find the - 0.02% (2)
.net com server - 0.02% (2)
microsoft could have - 0.02% (2)
com object it - 0.02% (2)
com object which - 0.02% (2)
com object to - 0.02% (2)
a .net com - 0.02% (2)
would be a - 0.02% (2)
access to the - 0.02% (2)
you could call - 0.02% (2)
the poc i - 0.02% (2)
a feature of - 0.02% (2)
on the interface. - 0.02% (2)
the runtime will - 0.02% (2)
this is how - 0.02% (2)
delegate object, which - 0.02% (2)
the server process - 0.02% (2)
in the server - 0.02% (2)
at this point - 0.02% (2)
an arbitrary object - 0.02% (2)
the object to - 0.02% (2)
getobjectidentity on the - 0.02% (2)
already have a - 0.02% (2)
pointer to the - 0.02% (2)

Here you can find chart of all your popular one, two and three word phrases. Google and others search engines means your page is about words you use frequently.

Copyright © 2015-2016 hupso.pl. All rights reserved. FB | +G | Twitter

Hupso.pl jest serwisem internetowym, w którym jednym kliknieciem możesz szybko i łatwo sprawdź stronę www pod kątem SEO. Oferujemy darmowe pozycjonowanie stron internetowych oraz wycena domen i stron internetowych. Prowadzimy ranking polskich stron internetowych oraz ranking stron alexa.