1.00 score from hupso.pl for:
saletime.biz



HTML Content


Titlepheenix::sell

Length: 13, Words: 2
Description pusty

Length: 0, Words: 0
Keywords pusty
Robots
Charset UTF-8
Og Meta - Title pusty
Og Meta - Description pusty
Og Meta - Site name pusty
Tytuł powinien zawierać pomiędzy 10 a 70 znaków (ze spacjami), a mniej niż 12 słów w długości.
Meta opis powinien zawierać pomiędzy 50 a 160 znaków (łącznie ze spacjami), a mniej niż 24 słów w długości.
Kodowanie znaków powinny być określone , UTF-8 jest chyba najlepszy zestaw znaków, aby przejść z powodu UTF-8 jest bardziej międzynarodowy kodowaniem.
Otwarte obiekty wykresu powinny być obecne w stronie internetowej (więcej informacji na temat protokołu OpenGraph: http://ogp.me/)

SEO Content

Words/Characters 122
Text/HTML 0.75 %
Headings H1 1
H2 3
H3 0
H4 0
H5 0
H6 0
H1
saletime .biz is for sale
H2
similar domain sales
happy customers
you may also like
H3
H4
H5
H6
strong
.biz
creation date
expiration date
age
seller
auction ends in:
b
i
em
Bolds strong 6
b 0
i 0
em 0
Zawartość strony internetowej powinno zawierać więcej niż 250 słów, z stopa tekst / kod jest wyższy niż 20%.
Pozycji używać znaczników (h1, h2, h3, ...), aby określić temat sekcji lub ustępów na stronie, ale zwykle, użyj mniej niż 6 dla każdego tagu pozycje zachować swoją stronę zwięzły.
Styl używać silnych i kursywy znaczniki podkreślić swoje słowa kluczowe swojej stronie, ale nie nadużywać (mniej niż 16 silnych tagi i 16 znaczników kursywy)

Statystyki strony

twitter:title pusty
twitter:description pusty
google+ itemprop=name pusty
Pliki zewnętrzne 6
Pliki CSS 5
Pliki javascript 1
Plik należy zmniejszyć całkowite odwołanie plików (CSS + JavaScript) do 7-8 maksymalnie.

Linki wewnętrzne i zewnętrzne

Linki 21
Linki wewnętrzne 19
Linki zewnętrzne 2
Linki bez atrybutu Title 21
Linki z atrybutem NOFOLLOW 0
Linki - Użyj atrybutu tytuł dla każdego łącza. Nofollow link jest link, który nie pozwala wyszukiwarkom boty zrealizują są odnośniki no follow. Należy zwracać uwagę na ich użytkowania

Linki wewnętrzne

- //www.pheenix.com
forgot your password? /../backorders3/forgot_password.php
@pheenix marketplace //www.pheenix.com/pheenix marketplace
back to auctions #
pheenix marketplace //www.pheenix.com/pheenix marketplace
0 #
driveassist.com ?domain=driveassist.com
gefc.com ?domain=gefc.com
utqz.com ?domain=utqz.com
jvpz.com ?domain=jvpz.com
vxnk.com ?domain=vxnk.com
vmxj.com ?domain=vmxj.com
vlbz.com ?domain=vlbz.com
xvbv.com ?domain=xvbv.com
whois //www.pheenix.com/whois.php
registrant rights and responsibilities //www.icann.org/resources/pages/responsibilities-2014-03-14-en
contact /../backorders3/contacts.php
abuse /../backorders3/abuse.php
terms of service /../backorders3/tos.php

Linki zewnętrzne

api https://api.pheenix.com
沪icp备17022494号 http://www.miitbeian.gov.cn

Zdjęcia

Zdjęcia 2
Zdjęcia bez atrybutu ALT 1
Zdjęcia bez atrybutu TITLE 2
Korzystanie Obraz ALT i TITLE atrybutu dla każdego obrazu.

Zdjęcia bez atrybutu TITLE

/../backorders3/assets/images/logo/pheenix.png
data:image/gif;base64,r0lgodlh0gdsapcaaaaaap///waaafgigugigtgigcgiglgigpiylf0mkvabi6gigjgignqykve2vygiglgvk5gyko42tprvbmgigfgigir/gegigdgigcgihutfss0yklm1udkmobgigony6dji2pjo+do1sagigbgykcgooojo+nfy6mbi2agygmjy2njo6oj4+bgqkcg6oebssggogag/ghrrlrkym67mtxungjedrlegyjrantfo2bg/gqg4cagocagycbgogcg4koj46a5xcsbaxrbocteflx2sdnu9ctvnl0s4dbg4cdjxcsrote5wmxgocgwsocg4gg/edzbpdzflomkwcpdyee9zcyg4cimzmcjypbz0m7/kx7zjdo+oc7ladxf3cstqnbk4ntrcledecdg4codgiigocbgycdg4gcgogdg4kpj44/jrdvfndfjsl/jwdmjgmeno2pfpt09mmelicpjycpjygng5helhiplrv/julss6ht3yvfjicnkschvqpoi4cbcmcfjignnnqpi4cjnvcug4cnjimoiocns1a8+scpi2hppja/iochbodokghtgoceg4gkqfpvo1syxsm6qryq5xcg1vlwbdwpkscfg4cjn4ts5ycpbrcnaqqegocpanisgycdgogi1pgfo4gpnvdrbqdfgocpkmq0o4lm1tmyxul/e7lhivcnbpdtgycegogprvmffqdy8vcpwradjzua4xcugyclfql1gogpi/rnnhwagenvgycnbqmpvxt9avdwgychgycpjqmdj+cigycpavepafk6gycjgychgigggggogycngycmgyclgyclfvtpgyci4wkxcylbgegkgdgjgegigbglaxlo/u0/gicogicngicmgiclgickgicjgicigichgicggicfgicpgygogygngygegicmgygdgicpexlsgicnivllgygprrt0gygbgicnjotdgygpvxbigygdkokpjo6pj4+ojo6njy2mfhxzg4ocgokbgygagicp///yh5baeaap8alaaaaadsaniaaaj/aasjhahpomfcbqdmkssgtazmkb6vmvpgisukgdmmswhfo0alzcai5ghf5biljkd2xmidbz1ufjrpihrjpqzjohfs0ipozrtbhoik9unuz9a3egwh1bntj1glrpvinsqv6rtdnjvwpxqvy6q3wn4ms0vkwkxktnwv64uoxs1k4mljfue37rhz6datgxdunf+/4oibawwsmbhx6+clo3foe0fika8ezoqqyqfhoea12xfxh+enh0fjbekspequfzestnkysro5fijrpgqz5yrnowxt2snoqtdfv4ejbbrvafwpyj1o/qmmkkywyn9k4ujjkbyup/xqmubuwjx383z9/2ixbx67y3hrqj/moc+8c33/jgsc7nz8woctr1smux9c/wyljbbmzjsb0rbdenbszxh9tpqbky1u0wmlscrde2igyglulhry00044eauicqc1zntud31w3jm7rrcufuvfzvykh5bnvzjgegfkg+e0ucqxiybidosucmmo72w08wvvcqtzztexbwoevixppdih8kxwdkmzrdmfvdsd45/zca0eeirlqgkgs0lkabnchpmrzw7qkzse2uucqzay0xoekcw8vaetlhfihuioylyilbfatxii4wufr1vsuxlk1oxkndvptzrp8tsb+zhhylkxpfhmdakokuv3hdttdewdv/d5dxfganorxpz9rdeiskmh2ccdskomokca0+y/jujiekyrdkdntsssgcsdiaukhvlhoqqg3yw9ce1fz5xxoyc0izticl+rcjxm/peik+lzorpvsyuj+o9jhocvb78zggginar5qyhbmybsthzeikef+de6s3d3thdtxrifpnnrlnu6l6y52ts5tilzuexsxrtp2xbkbhijg90sjtty0mmcdbjttqh80b3nhguhor2ag6ilrolffrhfa1bbyscsps+qwtll9fla/yfu2bo8yuya6xbrx15bjlhg/resqyxuzqyjwtmvmfgxb64g4453dx88zsh3ur3flvetfe69mn/wexi9rentjjn6kxszc72wiobclombcvrjqhnnn3i6edff/pwbmzl1prouircv2m7vzh9bnjcl3juuprytxpqvxebsfjctdgff1n00cyafuxchyrv8jhhkceyow4zztwtjzflsdvm3lxs5vfhf2ezmwo8wuopr3cbjk464pfn2oagpwmggt082+dj7emelq95dvrinyoloxmtg5jl04dat9x0vfz60vakjzvfgdbetwvdt5bcii2aarf6miimdmgio3jbc3p4gxeumac6jkirgybfkrrjdnjigb3d6iuc5teadjhdbhzlz67eiuo83qv77jgdmg4osrx0cs/i61jk/xk3oasb630kiho1hregllwow4+axekucr9xxcrd5wprh5kirweqryhayrgmemkbay4qdgdgcvkosog7taemx5gcirlxht4yagsseamy6jc1pwdid3/oqx8yqypdfoixdadfmojbjwtmi0kwxnwuqjsogu4kh8dybsh2gdhx6ku96zadkprwdne8wgzpy1mdwoxexy2xfw3cckawfy4nyqsln2ukcjb2fbqrmdpgyrtazbiupbwbdf3qqz44wbn96efrfzgcf/pwhz/wmrciuaqd6ncgpazid3m4gyd7cig5mlmpvxjgla5bjw94i2iwqxxfftw9svyjlaiqgd/mop8y7nmnchob3zqebqq/4oicivumgpziuaa9kkhtu01h3teezv0rl1r0x29gj6mwsmhppiurhsdabtdsrhf62a2jdkelpzrueivg2hvywec6dkela4gdh3y6ck/tna+osiqkjchiraivqewthq2oytg52cpw1/nnomwixonl5uoconyf8ilq/ydvqvdq2v6keq7osiahdy2wq6h1ucugkgm29jnn+qcup8woddnc3rejdkdz6melykyahrcwh0usqhbgeemdahoiovbhefxbrgmhqdmtufyqibadioxqb6nkqpyjaeqiahgow8vtkno5ivcxc40i/e0/vhktvl96va//frvjwbbfosrhjxdgyucrxgit4csaosvjlwulqexlbsjvqcjdedwob+ykogyoha8gpeo+sie7sa0bef5wwhd2x02xbzoyo+vdhojqbz5m1r2ppqrmqwkhqnj3vkyfrcuawynsptvwdjplxtxrhnm84bnxeaytrkg3xphdaab4d/a8p7gshwxw4ubgnq5df4uc4qybwv/jjqtqh76yjvyy120wmtg6sutfuxejpmc3xi8k8ibv4ebh70cgnrrhsn2ogh20ts06lpaxeyhdiaibsd4w+q+dig8inpeiqd63eljer34juqlzyfgugjssl3dxif7myxgijkaweawank/v/29ucs85lkemusglgjm8jbrrxkswoy5lhleuz5ile1wsocklmgpibyhjasqaiwimayk4mnpyrtexfphuwszbb/buna6lylj8afkh+tice5hircwqrn8sz3nlxp5sxcdm4sllygpvkeu8rpeee2bvhe9481/wc5h0hgkcxbkzrvxsbidakiknytkqurpqc43rlj9lfkjzr6li4yg5pxsxalky7gn+6g6yhi9pbzg2kpjtyyhy6rzyaej5jlo+qn4eluxb6kpwmrbc9jfaoee9o1tvsrbwbdbicgybn3gd0mgh3+bcf7wcm55r9ktrlvrqqg/kjkphtfoy1dpa4mqssf/jjeps1lqjihhcee1rcpwnfczyhatlwikj4bahoqa3yjtlbcmytqdcdiemwnvsidj4ihe63ahtpjkvbt5wtgd86osqrsft0sncicmbqb3cmnnl1b4vvolgfg89p9e31ttmz6pckbwikatfps8ukl/nusybchgfloxbpa4wszfdokxal0ejiyeqgqhd7eeie8cghgbxifidchb9aao6h6t0ypk08n1ihhyhtvpnlkiu9qu6j1a/eqxzahhblx4qjsuoj8kzv5mejbj+rwyla+dne2a7x4krs/ctzklpk0nca+ihvvvhinrydw+oupqbxqopkx509mm+2jzjxa+zmax/lgiri1myigdlomsq5svfqxcbce6yax8c4yjqi579odeq/utv+li0gg1cxnocoibdomz54q/glg7xsaq0ie9sgmhsat7hajhmrywfaw8csbc3viatri0a0tlpqw+wcuu34xyxqs9ltffk5nji9d+knnok4zpftfh6sgr64avgsaq5oacxuayx4auigawsqar3dwh8cagaf3pzpm9qr2wybqhurnptvgmnvwqs8aicuakduiwsifvisw7+gafenw23wfrsemc5j4ei6e9ndxdgqe//5e9smber0tiuqsgnxwbpl3i/sqd4mdrpwsjfdldes1fhvmmvika4hwwdmau+/xalpdalxgalscamvkcj4xdnjzbq96cigzb6m+bqlsb1prcfrxzfuihlpsal/lciabifamgl6+akvhcb/ncl69aof7aofxn7ducxwzamqqu9fbh7xyabedzvciihddgmt8azmaejzdcqmrebuoehe6aucaqv8jip/wnp4tyuxcqin4cfiycfeoai4rckdtcdjhglrvamp7akq2amvhbnqzckuvhuouhqpickq9zv/biksialbdagsdiaphamnmaktdgrjbmflfsadky3ysangwigismss/y98nbmalaxyzh7ghanmsb3zpcbemauf7ha8sjzhxeikkyirxewp2fzip9wcrmwwobyczr4ibawc8lwc7hwc0syc7madbkgljsabufqbasgbwkzzaugipvwf6fihvxpaqxaca7gcqzablbqcfqykjzaculgc6zacrzwdrzghghfn78ighqtdmqqkrkyhwb4jekayrcmdssiocnwdyxofiqiuisicagsnemdlyhiigeujom3ebbkc+ixc2brildgc5loalnafq1wda/jdbqgllbwcqfwc+cqo1/gc6hieoswel25laooc49alqpim6vqc6zgcytwb4kwr4lgllzndfzfclqlw8diyxyrwgy4lhdrixiogecjbalwk/4aaaiqh7n1dnqncigjoon/rhr7wbs8yrvecubpuzoncog2pweokx6peh44kjso6au5yi/hr4mzqau9ycunaau/8autuau1sal20azx8gpdazzb2zw1qblbyqkfsagcyfr/oaiyzvrluxqsiiaap2vghzwcdsxhipfhkgy89zdt+yamwqzt0aizrjjw4aqe8gazuie4tbjg2xc7wttsajslogk8msklujtub5krahy9qrrykjoviinmezsbyzm+iayzmbydioo5sjsn0au10aq/ykc1cayh0e2bahqnmpapkgu8gqwsr4vnyqqjef/9jocysjygsgioejyy2csnulsvv4cqdq7aqazuqax4yqpu/0afugakimmsamagzpbpwtws4cohkxedpqmvtnetrxpuiacc3lgpoqd+4yeaavqlkugo5cegv0albnomqbak4tcmtaalpeakb4emxeamdcoi+heexdmhspcfolukdqqcq5dfvdmaerqnv5zljqapmwgiemkx1qleyham18aoeiabbra3geaft8mkegfs24ob2ulm6upbjnffxurymic0rlpycdse3eaojlihuaoljdclopmqlngksgcr8zapq2muv1akyfbaajumtvakrvcxpdulsnainih/g7ajdoplfaoic1ahgxrofyblqpzlsqmtwbiyvnd1/izwnkaxfbkci/9xpqlfcwbqde4sd+xganvqcubkbnytujiuvcspw8bgn1qxkyymkepsip+qg2xeoieylisieikwbibgilnqdmjaj6k6nwk7q6mwpb7qcs5wk28rdssqcrvqkavpok2gqhwhc0yvhvbxah26hvspwvyxevavsq7msqzxckzapy6ldtj7lungd6awbj3qzlhypevac9fqan3wdalzddzqdavabujabrgsfwvif1x1lojwdmfgdn3gdtraievbi7dzd4zaph8il40hqj6xbys1b0kiqp1wclfac70ac4sgfrmgpkbycqtqcubqc5gyoldaa+fqcsqqdhlrpruadteqcrd/0ar6xoskj0h9o4bapl+o6gpzigvvj4csqjaaslhybwhdwavegjyqzgwf8aquaftwdq614a7xga4t8w2ewwmiwwgr8a3v8aamqa31mr+1efxnma3coa6ougzqoa3cia6uakzuqpn9scj48aaugau3eavmmfjxeh3zab1toatpgh5csac/wa3sekckeauwalcumwovewzxympgilcnuavnca0mjgvzq70fsqzxi5sraav6hmvrsgxkdl6rv5ab149ztnrua7irh7gvs78drwhcwavq4aweejliwazm0azogays8jb2mvxqoctnma0i3a2eqavvmaz2004jxmdy04vi/4dbwlam2+aqxbam27an1rvdv6ebwvdcgoahlmaer/aetcaevzaftuauyeaerkaeslcavccz8ngkvwamysuwsodeboomrism8+kltjcdk1gkwualqpzexfcq4xamrrcjy0ub+xwkvazqemqkxyl1itrgzem+sgjg73vga9cijvafudyo5uaoammm2wan0pdbi5eovpaqtejoweafgvwi4fang+o97fqnwlaf31ao5aany2dorfk63kan2jcui0z4pvoeuibrpmwecsaeucadtgaetsdctoahyoaetkaeyzapauslhruizqutxzolqramaxkmwecrrfigtdalqsdefp9qw62qosda0ruoc+jbsatyha7godhmcrkg0rbjzvx3of6wzr+a1amym41qc5wazqvqjhdjuqbtwepgd7bgdz9bk8tabkuqo48qbawadttjs8dqc7rfdermajp8ua3ymesidbjgdipckxwlcnhacvuwykoqbueacnxnbbyt2eewa0rgaxjtbb3wczyscz3qczsay6fwcbaazphlcr8agntrokdxc6uzfqxqf13cc8dgpqfd1jwa1fmohaoyp8cg1prfzs6rp2qmv4m7sh8qgn5ccpnmclbddtvwughcduwwdnoqduvwdeakadfgdaxqbavzciwqipobwojadtcqdop/yadu4a6p7lmwwg2lomzfocoygnfvjxzaei1xuavo4arvgnh+aglzldfhcarsmamopasfgazdsapvolg7gaatsjuymbjboga8unq5xcwfyqqlmaupvypfalb8w71xkwt+wxpdywpy2sufcgic9adz0af8dcasxwraait56qgm0ntr2qihywa1ka1gjwu20wjg/q3caa3lwazcufrskastymdfmn24vghrmasg8a2t/lqbew7eiaedlne1ahbsdavq0khvcazc8bro6zq9yqh4yarkam5omawcrqrsgao6kn9roaousapxkgp3fgvp0ap5orcgksufwr/k0n3rydiq/w2mwjaomb2bvsrs4vcr6zda25slvd2sksubevojrywk0fyclc4lng6th4q4dvmha5nqrjajoz4n3baxudmfsvc53zan2edb3rdi8xapr0sn0l0e1i0ertdrddaabrbr9jwo6qao4+25xgafa3xbadcfmaan3sc7qng1ejdkqdzn4ixrlbwf9rdrhd0emib+vvcishklb1ekkqdftiwo1xb6spaoqjalxdiotyja83enxpvtburelb0o6fao4kurfysoxlajqvujehpaqkihsmdi+wfx++xbhpoonscflw4km17qqf4qyzapcrancselveaf3swjy+ao6ndrux4m6p8ak2ahdulachdubbwgdrpgae9ck+bqsepaahhztsj9rqygta/y1uibc0uwbml0e2nuberabfyf37ztbvbq0xhn9umqbadqlk1ac7fgdl2g4kwoghgmdruwc6vgvkvwc1yidlzwlmgsdjxzj7dwfr8k6emac5kwcplzscgwdstwcxgwcouacavwdo1aucv7ze5nzvoyrs4odmaw4wm42zl+8f/hbjp+f6xadleqdtypdl6gnkmqbm6q7tpq3dre81li1a0cdt7gdsbqczv/mekwdcxo5bxq0hk06krqcn5q7lfve096coiwbh6ib2eqbm9g0uza0fqdbbyzbumga/x/pqpmgccrui+zimtokr5fusyoow6b0ang0alvmkd3vfu1cav1oaygyay0ukbfdg6vabclekuazixvk1mmjc0sha3rpkq8mggqvjetp0r9eiuc1nejxyuanhjkxyvvrvypez2z1dkukvanodua8/jlivpasmxt5k2clsbv2fsz4oxcsw3cuoul5+2btw/eudwib8fppaxcniljou7cl3lbkmodhgtkleafkkqj1+3atxng3mczrspwmvpydt1gwsphdsdhmdhxoirjfs5trpqyheuoeu2zanea1uvxmxhpxokjfm7cz2dnzg1kvaqwrgcszlekdi7alnidas2+vapv/6lz4sjljurgc5hspurlkuuo1ffknfgrslsr0exmhd96jaroeb0+fp5s7zmzzaoureyds3co5klobaqjf+nkvrkjclz9y6wefbnswrrwwaatmzef0hehngnyuucbersiz5p43pnvg3cyemcdczzrr4kkugmgc7oquekjr75xb4jfzmkalln8qtgwzvjhiz1vraescsgysfehk7y4wokqcfncdk1ooqacy255ppzjxpfmmfl6wswdvz4bphrzijhlslbgasyyczixzpzubpfltivhlmuvem5zb55ufngjeyproviwtkytk5vm5lgjuys4qaspjiqhikjkquojjjocgf/keea5a2smrsatz7yzckneiygyitslqlwrjpd5uinqf3ckiiukkaggrclvugfnhka8yyewbf875ppuvvlmn3hegqeeclsbxzgjdohgwymg4ci5cbpxbx2xuilfxv9+aawzcyz5bjzingaichttnawaoa6oigpvmzddkluqiezkmco5zpvzjdgmfwlesuuuk4dr8srwzvh3fljitknkk4kbjx1/4bhan+aqkfpk0iijpszl+uidz4s0quhjiwchg4488qidj0eg2w7lrjtb1bztaene0koasairqgijtbbpihhglwnmkweeedtrhhmoqjjimagyuuednbjhckaaiyz/clfpveohgho2kuedwsygicliatljg3oeyefybqiwtpluwihll9domykikiya9wklpezicw+tykigwphazeirksfmmftkzfwwzoibzvljl24nhgdsmrpllymh5nnfktmgfwfus81iz8njbzijgxg00isq4qhkiyozowxcb8ko5t8oas48xkxj5i/mdi4iiuxyfo5nnadxhwijk+ogawxdqaaycpxggjvduok1v6/oet+ddda54btnurfqm6s2qebpcyqx51hm5plgq14kiawvx4tr5ia86sajamtcuzhwhr0vzjfogaqwpscahvujfwwsuylci47kos4yv4lhkckx/4lawgw1wahhmcq0jmvmohw1aiaaevxcczapgkk4bs1ssymuocd2halzc/rqbj4wqoimwmr1skmdjynnjyagxky4wgyrmcdnlciej7bbe208jx3d6izycieejjtcp9xqxzwk4b/yfoyc4rnfg8m3djz0yqtc6ci3mcgmnwmjhmzqiltu4y4ghcm3qydfcpvrcym4qq42osirfqkedphiruei0wbwssxkfqzhv5onl9l0gqwcqxxqssczfrgivttov5lz1wbwwith0kiwycjpavzeijupoxozwauiblikkxaie4/ibo0k9rxc3a4rnybijribhdz5dnbnymrgzjyrqp+jpa+e8mjzhngmbhbdlnjdb9qg0iqzlo0b3shhmz42ag2eyx3pocc951lp8vndc1ugghd0by5mqkmyy+djg8ahzqsigzitgfiko3gfkvial5q4xbgicneowogivrcc4jigaxvzgheri6erwvo5kqudhgmqr/nwib5kxcmvs+hekmxija2dixi3ke1nzhelypydfx34g+74cahokimwydrols5cjo8q4hfskmkxc+a621lcfb5saigeqltffy8qnpiiokyzo53prafb8m+xxnum+6htajw4cycosi1jacmxckbansbhd5cg9p7raauxttcic3hghflh4law9g1urfb/bqsobvn84ytiieejfgecx3bqg4sm4qhlmempagagossbxex4hcvkb4omnmeteesgz2j6c2daa7acg02ygjmbtsicf/54xznoaztcygjrvkddgq6jkjq5gha1mrpazggksvchzjlj2uxaw4mumyivy0acfaawbpbc8xcbkaunhjk82llkev7y2tm+isefgcmbtmpgf7ybdc9mwqvocoexlqfhahqdhvbw6yltuq5/liekylgck3qjfa1w5z/jwmc4uninu3ycfn8yrzri4yx0meeihenbfkagbef6awa++mezmgca1zbhfq4zaw8yxwprjhiytxjgmgoxic3i4jbb/60uahj2dfj0iji3wge4miij7adkqingxcymblvweeo3turin2sihftwahoy4mqjvjcyogrnuezlahdk4qxzke/pynovfzirjlykigtaqow3zobxdtqjevwglyuogdcrnu0cdf6wp9jbdfsiqnou4aiiweaibnidgrngbzfyusqxdgnc4ogkld7xivoi7bjjcmwlaostkpjacey6gg8asgjvmvyacpbde0lhcn8kextpeezm4neo2sqsgwosts1eiqrebraer2iclbq3jmqkog1r6ejh+gbwshjcgynjbsm0tpgzyqqqjgozirsfiuwuohfsgeiv1oyjvlticltgav832memwrhxz6x4xr5l0qgwzeekyireomqhjgnhqbu18babmlgfijrcg9qqgdugwb5wngwdiguhmhoggb7wyhuvaamliqhfxhgjhn88khzyl5nfxqivm2ifv8ahjus8gqlsgawtnnagb1vbtccwgxx80qpb2ngmrjadaeibm1tkxh+qumvssnenzexohq6kk+qsjspx2eiuc5ick5iyhixmwunemiidfmvltdthhbyd8jka0btdagwkf1hdgxlfzuwkdbbrgemtogaiijzjgleaahtymq0jsace3eagj7r5i5jpyadokelemwgoxaxdgcja0dzmoq1mnoisrkkcmpz/pgbfqcmp4wdwoyjxjcykixwhhcatqkafsitdgw1oadvy0yx4tkab4+wgh8cri8tgzh3gsezfbx04px+rb+xi0rn6ghuvp4g0ocjtm3wbuv6da9tj+hxp47sb1niscdip0qcsz8kezxohszcckeiijpgckskdrsgijeaedokscyce3tgyrugdkegdqcgzlhmitgceljgx66cdtwiasiacttavdfafddggcxcvyocex0aabgcgcjchlkacnkghbuajqeggk9ogecca+ggfqfiwzhgacligyidcpbgnwdkhb9agchgavdoglqg5qqigwnagdygh62sfbqiftogenmcd//05bkecfmmwetmahbvhaaw7qczaimnoplxiqcqglxgabssouy6zjf5ohbtrfro6hvpyh1myp5tyjkuckypjdfdkds1wgmqabecwazkbwccdcgobh0ronuswaynoajuog9vbhuyyhmcrqt7qmefohv5gh1saai/qiiushi5ap5glrg3qhj7ovgyhb22ilknikf4ggmnqgdpqbxf4oxmmrfzzlcfqfijeb1arhtqrm2wxvshcqgawgyyosylobyyabyutbrvjghtwbza4kb4qjcn4uiqogsv4gidigrvogh5oaswpgwrmbl6ahwfyowcaklmidogmbnjgbvnwils4bf+bugw3w8rg4auuwlxeiym8geuk3irnaa7woexf+wloq6ar6ikiogqi4om2iimgogtdyyrymab2kibeelb9owzumifqwytncyccecdtaauugajwcif4uar/4ikdgzklazojuacbwiuq2zvrig948azlzjvwkqu24iiu4aiqoiiq6aztod6xaibssev1yipzijby+aqoubc5el8ziaieyixvsqirqlzt8scmeij8napdagcd9irxoawmpiyyqwv4eauvc65aiizxuavakiusg5p24otqwcmm+hvackjdkbmhwrotrim1ie3s2ig+uaq76ii01lspsawumkqtgqrmoat/tcjg0nogx/acdwkkdojboukgz3ahdyghbagfjiacjcieczgh+fevxqgqy0gocsqhbjcebvgg8qynueiwcvchcsiad1okkigvflkay9cgexcacdgg6zuah0usauagrrifsvcchvikizcdfmccmfah0fqw2lkcjhcaonwch0cdizidcs2trwaft6inwjcsulacedafklen5bogjcyfahigcuijxhifmdcmgikhqgjfislbq/gdpmi8ojbnoliud+sdv0qzbgqwiuiclpnalmmgcsiacnrhrvccinccnyiwb7gi9skgl0cctpwfluwvxbeaqqhkciztbsi5n3gh7ngg/4zcbzlyrm5ab3niim9qufbwxm1wbznkcrjxhgjhhgkwbqb4brvhbf54gw8xa4ssadq4lydydnccvh9ea8ulgjlwbzo4vh/g0p2te8jrkltgjqambin7ufeilhplbwxqgh/0gskhhuiathleblvahjpcg5ghgzzogymc0uejikboawhzaimdakbwqoxghfy4koj5ikabairohaj0lf0iqm4ohwfq02xwfqirepebh/9ora8lv2girnwahmkybqdy0xhcqdiybqqsaoprgamyaakoahaibwoqsgcjkkepmnuih1jqbvcjbtnaktr0stoquogeuyx6p8v8ass7l9iqa/+bninmwdaliyzgmav3bkytyzihuwwsxy3wenwc8qkccxnmmyi+uirositmgqbriim4ofnf+vxg5iqd6bslkaiuqaphyw5m6awtzj9rtu4w8ojsmidcqabvcadzqiby4aydkdlpjibspbzjivryaaru/ccrmyz5olniggvscieoss8apdv1icx3ieyfibzzmad0abwybadxqaczxkta4j9c+ova2kgekimyaicftqiz8acbkioh9yeixyte9ycmgfabgarraaygc1mdqowsgcnnmduawr3xwb3yicfesjy+km3ggzcymlguwa4uqiwphefgem5neflsoiqpkiiiqil/ob3aickfcajaynkjzbgnwdagbcah580vjco1eyjophckapiauixxkzupuyokxwgkcgchevhtufkgpcihlyoqmv0pu1ohpqjgp6garmc1anyquygk05afyjcdkihqjgkars0oapchkickhodcfnsoc4nqym0cmxgf3nks1agnixeu8pgngjgcubuplzhi4zoitry35qrjopidxfcckegc64scoeayurzfoxcdrdidozidh0u3imqfboiscpaabxchpskgr3ae62efp80i6jxbvoikctaguklgc2ch89wgz+jwb5igp6nsb/egpmogd8irvvsw7/xobhyqmpuecdgg/3voafcbtbxi2nbqpwe4a6trgnoxojpakignrsigwam1ah4oa1gqbluocff5qdppsdurafuqha6+yjfkh8ljpjwygykagy/ig1z1qa/sautctwujbf4nitfcbjpchjhkgzwqyugiay3ogzw7m1ptu+atgnkabs2qaki4g+7jqqrt47aazl/2hnigbwmqtirojwkggibgtdd1buxbwqxyjagy03hdyqu5gljrwnko3lmkeh+bbxtpagkg1kgigvcjxdpqqooxaj/ovadejuyajl6whxtofwg84judhnru4lvlccolzdvtgi4aazly1dt5pticxzdjgppmvtcsht/ajv+sweu8uiqvkaipaaroaavoiazuccdltiplmiawujpaifu13qb9ypxl66krw8zwazwmtyd5eitvgd/ojaclefuncmtx4spwul5n9i+qcqqrad9ragdteiz6hzvo8iooxqqkint3c+cqigenqmo04kjj6qer0ntywlxtojo3a6er1wbjzg1emcde8aois4capadawfwsiqnerqm34fvooomepueliaib3h0iwgqvswsuqqmj5li/6lxggayjgizy4coeyl6oiycuqajzyaz3kmgogzcobqcemn4x+g90ciztiadjcab3qn5wcadh2izjqiyqgrbgamnmwctogjpthwr/wgek2epqm/yept4hpi6g52fjnvqht16hi5a6f9aocizgfnw/gesbcm0c0ko2xgvrchyaegaflxgph4eh14ihydgnrtyjrs4fzxmhrmg8obxzxuxozb0e+rbwfmyoondftzayq0azuqseiiagpxggndijt1jpnuaqs+gjba8n5bohjjygqokgqjqck5iebka9o4msb4ieoaaeqgjhokponyuesvaab+ajln6pf1o+rpjxgzcq3rilthcnon0gubanlieejbcc02kdcp3jmxi/upcemgjmaezutdxcxb1yvnapsbqahanvubifqhah5udvy2nkdccemhthkfhv3eed/y3oajlrrjrqhzttvnje1utyhnbehfgghclghj2qquwdt29ybtiolgbqu0aohwbqbnf44saoh2+wrm1yhi4wlyjgxw0obqtwl3bqsyjyvwelvmi9gmkgb9yuhn31hvj5id0abhpxahgybv8yb3d4i9bjelyoaox1g5et0pcrg1sgbvlybfeyhqpwrwqrzdkq0dhgave4bvx4qfjyb3o4awcwhrldetpdngubneudbc7w0vztb1esa1dwljutwse7drvga/6mg8km1vjihljgnhbkhmvwyi4sbqkpwm/gpqfagl3gogk04igmfjcyo4uwtlgo3m7l8qhgbnqwhuzihp+yyimpcajq0n5u5qjj24xub1/itneyko+pwyzzuckkkzxzeico2fsleitter+lggvfx4rpkix3063cvvwj7d8rsqzlsibqwaatiimeudq1aozosaal9wptaarnkxhkpal+vndx3k2uwqshpzrv11u3unndgqrscker6wwhsjzl2inogu52gjzf2pqolyiqgcdt6mh/so1s6qvwzqndkwuukaucig2p2qxkaays0gzcmajpeiqoclnshe9m7d4bmm1eav/k/56sgetxafcpndqaojbrggczeawzjwva9qqce4zcyivofes74axtwrh3w9we+kxosivyiavygivgsad/n+cczq8oemcfuagi/suempbnmrcdd0xsda+dliaoqbda+x5zmsdokwkdtzyzpibeb5ghboc4fuwfbikabuhmpuhds0bozy6sajbkp81tec0fvemeyzhbdyhcyu6oc7jemwkibttaivgsjmqtee7ibepwrzu3bumerds37qk4jolchdmo7ulfc+ngcrgnknu6dfjaruu3doc0vatmnypfqtw6fmzmkshldfasyueemmhlqumphgdmfgp0ahzuwkrircryqj2dnvrxzpndhw6dow3itnfkdg0dpoo+tgn75cquov/rgmwuiayznvuoqokdnq3aqynisxdntoixkfns/ymytvcbq23llmxl9gsjzistecdirk6dq3dg1clwb60wphdnhjxrjqxyq23agol7psceo27f0amrvetxmqnqzjv0ztzbub5nwp5r7lejyheiw45m9824rfaxsslilu5eljircuwc1aovmq2zysxy5z7ur2birkwcbasxk3ihkpgcncsyeevf4ogut0hsflpaabbvx2uclvydcaa1bxvceogehxyglryyxhjirrd8dzfhw2kjnphs2hcebbfuqfpzbn18s8we7lqgtsveengko8yogibk23qtzjcuagonlxissw1k3iwdztbemmmnn+fw44sxeldzjdostebonpa9bp+rcd+ai846pktjenmgfqtsdon8i5cqzj4cvcy//ekmjrnqdmqdvzgtzi2xqfmme+w1uwspmjayvx+9wcljkvhcbaavxsqchr100rghg3+ppsafxdhbxxplgewgg22bueeuvqackliiucigv1xmmquuomybllqmdfbzalequkuplwxtejxhlooaazw+qa1p87bwjjnc6cynnlmtuwxsdn3zdzmybipkn+j4k406uxndjju+ckmnmccdz2y4a2z0zjrwvprmdcl585k60gqddtmy+wqmlc54a84td36sp56d1lkmnszoyuwz39aysx++tgxfkz245wtus2tayhrb0dh/ykdueapwf12i0cuvv+rfflgk0teffefpcqfpdwhxxrxadageel34hbgjmpgyqzgiffboudo+dky5vhjm4jy9gonxqxczoq44yzkjl5hendsnobqhey422swdr5fnjnvdukjxji5i5yrqguvwwjmorhe51i06xon5mjyi3emll/a1uotuevpyijcxcnpkl91oq6030fg0c3nylmfeef1bjs8swjji4rw1/wwwhwdu7oewunyx4vdr1nfgwtvvkfsgp1escfpdtmhf04mwmj0p7jigqlugqdnmvd90xm2yzb87hhepg9nrrec6w04dz14ezsmboanbbegce865wsyb/zveoug7utjon450aiaiktgcaciyjpcagbigkybbzlmnx+rcanmcbaa+arq9ewmyapijlxjvi71vkrjqud14fnk5vjtdjvz5lh/aiayvcaekxkbdw/jahz4goiwwgoiu7gcytaskvxsjg4sapxzmhciomxui9kjmf20gyb7qojf4vne3wifdsgwc3+hkdb3rcqmc6whhn5jhjnlaqitnsoy1ajoubtrtwakrerme4kybwqkceiaavtgskyeli4eckkahafclarfhdadtxy9okquzra50v8dgtmgtwjzd4hb2s8cmspgfllkht79bfkbomy9tamuohuqcg36lfg2h5f8kspjcf2qzxdvxysx5qmmadbhftawiqqgkpmcmj0w7/eiby2cg1vs4t3bijx0b3jv/+vanckxaaqqqwliw0aawmwntarrnn8xrdnv0cwja8szg9hgvcixjhaozhzgm0rnpugmca4drn86bwepcyxx1kyc6uhgmylhjkpja3sz605872ccx84gf6gqhimqaixnaqrzkgaku84zqgahzadycsai0fgfxxkmlh6axfjps4qpdgesdgowjrwjmkzn9mtj9soezrxgzmnhek0ohuviszuxnsljdvlcr0vbvhoaqhklmgt1yukmncvhngtecpncyqwhz+mw88pkjbsahbvr/xndiwiekf0vqhbmozy0qw418csad3idasugklvidsxuq+nnuujfpicakdxpcbqhmqqtkfkmxu/gcfczzc3cc4xn28fm+jygwludbacbaiiog5zngsa9rwvqldgojq18h0vnlxaruj7qjtsqiebuy5cd/dwt1imbfdswirjyiawe8lkzbuadxb0aomgkjhovoqzp8za7rmakyw8hwn1xikyu0rkhkm825woxcbsxjgblxxjlgy9ybshvo/qmhnbzhe0dhncruyy+eatwmz3wdc77ohsyoor1mxoipfbvguk4xewxkzstpeyzuicez2c4rppuiqtkjxggekuxdv/rl/ybisdtwbeisqkre5cx0ntndyyfqwr6mgpkvc2xjhuwgox6x2oovgmgf2nijblardyqbeyvdyec5tbfeafjjuvdyblfjnqailks48erynq7dtndgjrwfokophleizzrjy5enhbgaxm5unkmzbvzib1qr2wiw43wweykmytgxwlshvaqkrfrwi6rtvlytisjfjni7puzuiza3awswb8eiyzfvdbfeufn+uim/ucmx9cqgzyyq1n+kbrpsry0bi/gflgrbcktgwiu+eqyzkkk0o4uioh7hdxgqbadesn48lixjowqrsbzngjw4socyie4ybgicfaqgheyyirjooeyrhp/xh2+6a1zemib+xsmmzfgjgbxabiwmiadz2mmbuxdalibccj7b5fhfwisdsitme2eifoea4vrgthu+4hyqorye8hk6lhplquki2oqjlp6xqstmk4dghtkwj2upcwod6khrwrqxd3tqluq1cayrzk2fkncce42aljm8gy4ritfts3nyyb8pqxd4ax7fcixzzssltfshewysrzpimrkhyznaxwfgfkrahs1wgq2wklvusjglei9mgmv4xvnegosxeo489q7k2gvsb30xgxsmftqvwoew2qrmmhrwfcogjiyycruuxyhfw2bw1mcpbxhrqejmfq4wjh6fef0me5xmrsb/blgdacta2vkru8msbmelbfafyj1brre9tru1ieqtclwn/zhzhnnqxkcggfibeaijrubcenjai284t0nmibk+rip1kiaieicwa5g5kittgambxkhzltwhjemsp3mpw88svuefy+gpkpukkxvqzobfumwbpfjdibshcgkapvxbxo2kgrehpoqbzptvastualpidybmasi4aipejmap3n4nqideqst0qarkwrj1hknsawe0giemay+awzqoganiqb05uzywwxrqqrd4qsyautpry0nsrjwegzcgq2yuqs0415kww5i9tdgcljiiamzqwrzmqreuaztxa7qqi0nsmtcq/wmbmb8hseijtgejjajugjb7gmm8fimx2eo+lyzqjn08bi59veyxpmplnvysdbvabmifhejvkqiixahequgdqbydre2jbeibugdggcpryqineaujeeiroeengmhlnzaw6bad/ehueeecamle8yeihoamleipbcdtgiq4rbhppdcveqmrlfyujgys3gcucba7taa3eamn8mpefieo1aksmgm7uem6ean6cyksfaev3ixi2bdfee8xzu8/7rmzneiufeihpeisvmexlan7wjazfgpa3ql7+mjnocxpogh6nqoiqggefim38eijuokdmeibbseasa/f2r8jkiik5ieyyf9cwhuvjojcf7ymhxacj3gbfsqpfklfh1ybe3hbfvsbx6jfiybbggqbfuzkrapnetqcdelgl2ghvfakfzqc001biydh8xmdkyicmsxchwtnh3abelqbcy1j/4xdobqxdxlbegwdfywkznwdozxduvrg43gtxoxjn0rbffhbelibkbwan/dbzqhhlxwd+6xf0ukfucydtarf6hgdm4dll2imjdicbpcbqgtcl4ffiohkf8quicrcao4fhmrsbpgciuqbbilctckcerusindqrpgiokviw1hiiwikfmzbmj2grixkfeiif/ckkmggluxd9bmdbjsc0ddnfasdaejgmnd/qxdogrrgrhwwwwnqsbugwsgeujlcr5wiazrg04twgxcgwrz8qdftqbfkqjb4wo94z7m0lzqvq5r1azj4xjeqqza0garyuc8e2c/yr6i8k0nqzfotqzc4a7guwzpbezheuzeaqrzuggs+407rch8mz056cnmawiwjkzkpmb1ogrykgik4gwcoch2qwrxqebfcujjfer+asvfmasf4cbj0wfdk4bf4gtm4gyxwwmkwqhvmatgqzm4iw3cmzibwbudygjhww2cicdbswwabgxi0yxquwrtiguiyazu81tegdtkua7r9qyyoqrzoaremqrdazn10c3kexc2ozjdqgwt8/xnbsymwvi596mnrrb0s1j04venyngqzqnivhj9dcioetelddcszsieqpulzomovosifjakaksyh+fsifqim5mgv7cr8bokwnnyg1jasdmeuiahkxrqmlbrnimeuemet4zat/v0zyccyluijme0tfbc7cgeyrjk2/fmrpiiwieadcmorlek3saibbeozaqmrdkeqcmi2zmmasiacucipwgemieub1doumakqik6mwjm4yotaxnusdiy6hibxmsnpea6a5jmdiiyhximwqeo3smmowzk3vim3/kqxoina2vmidighuieuzijgcuairiyuzjr08eeesaijkkrcfgf8dv8cmb0mbpwnh2gi8qxgnalgvyxnemsfeixcmxsdo8sdazgdzdsclfrlzo3dunsvycxqysiafnznqwbrswudnuwdmwzdre5aprldambpgswdcryjrpilfzmdaegimsjjmvbdzs6adfkrbladolwhn+rte/weyuscaobltxidjuadgixhvgvft6wcnlifoxhdqwndj6xbh3jifqdcxdkkzpdbfrdbl7zlohftoggcerdbecgbxdrktjngivodwa5ciurrpmvt0pwwhljcoaidbaydo5xlnyydq0xjoigdlhmgexjxz1arjikfdjhjmfzdnerezj6cyztdyfetpncnmpt/wmg4gxrqgrcsgggwy3z5zzgyzjmiazfuqzvkxenipbz1ayymiywdzdwswzzkgjaygwo0y0ygtnkugy+sgnvmw39u6tjyvswaex8eafwqz99havxsgyxcld06sqrhwidiwh3yetvijubvqgkaxa806bc9iw8fj6/mfpd8qsjuqibwapnox0ooa9kw2qcjgw8yc5mesocaiuadrjvcwzuwjgke6hkajqcnbdywxjpeywt4wkr6atkwwxvfvudasog0xevaaziyazoga0tiidcamatrj7jii+d4drncqkgzl554tufwww2qajldgc34jlcsqr7kwykmbcndtilqwhdn/wexjik7mgj3iimsxbja/gevw2elciieggx1chuf/eefxder2ak5ojmeleo3bo4awqpuyy3whaaab+yzfjiaf8mbnma2wa0ky1nhdfbkaeb8kuuyaempbig4soicnq/guiizjeup+imjawakwwmveim1einoam453eqtkcmzoem1apgwgonuvgwcbqvtcuqrgawjbpesmtedkagwszy9lgirjmmm5keo4em8ckcwae4lagw+dsih2mumveithamxbf5p2auwhiivcwiramoa+jw6ag7/dmr0+amageiwvipnngn8bne5ueit8aap7easmiipsairqpmywmeyvhmudp8bpdezpucbgzijfsibhbbbeuxapqebqa+0qnfzdhy0otnyupzzegaummwy6atfwzrwmxqd+1vlnnydmwrfd5atcutujqiwatnruuha9kznbzecd0gzl+xwihwvgpmcl4ydlbjcohbcb80vj1qcifqciqdkfoyzklcb8zmfhucmqmrbpnnzecjbqnyiquf1eowad5jbiptze5qzqadbecxaex41wh/1diw1wzf1wnsawtsawdsae8jbphxbwt+axmt1dds1xd81xtc1duy1lbddammccvq1p7dcl/ggmkihlcadmvq1mljci3ccler2d7szjxx0grqcifiihytqu2f/xwq+j4xectnedvmrawlh9tyfnled9vgtgwujtwvhnhgknw3t9lzftlwbqq3gnm7b9v7/nndjaa0mn3htaacctz4kd3kjaaiaqd6cahrhnwqggarggwlcdwhkd3yhahd3t3chwd3caz6mt3wbggwtgrokd1yj9q3utg20t3vht3yzn2/ptv0bax4bqxdv928pt3axn4atd3ilgxjp93q3n4lng4i/9wde9wc8oiq/+hvj93xja3svahmxn3zrn4d3eajcq4eht4il+iepuimloauenwuk+hd3d3ip9wqswiwvgbduui3bea7kuarkgarsei//+i/na5crqizh+iop/7cjnmcel7mhm4chnziihwb4g3d4tzh3v/mvq7mwj3iks4ajrhikbzmke7kjapixr/izk/msrzmbzzisv7ibw3ici/l4i/k9lhmcr3mjj/ihhzif77mda3mwnziyfzqzq7maw3mbzzicxzmbawf5xzeklzelv7mi4zmb4zmdzzmnd3qcf3mre3qy23mjv7qnb3qna7qnl7mka8gej7ermwaqjlqka/qsrzqmlzqls7qjq7qgozqwn7qwdzuxk3eo40omc7qtxzeyqzihi3exr7u0n3qmbzusl/q0z7u2bzu3z3mmm7uwg3qmr7e4hzuylzu6m3u3f7uup7qvrzu8w/84hou7sap7tcc7su/4nxo5iqt5r+v6q8e7wop6dzp4pa98hmp4uct7uje8w5e7td88qj+awumdc+sdpjj3glv3pvi5x388yie8yi88ybs4lbs6yhc6tns6viu8xl88vmd7xc85eij4pqcbgaabgorcgabbpasbhfyc0au9bhs90r990q+90l+cbts90z+9beyc1e891r+31ss31me9ci841y84hhy9sjm7rw95yze92z/9ohc82nm3jecypfi1grionj9y29e93d893ue93goai/e93zuyqso94jcb4ev8e5wb4p9bgiz+4qochdw+5co95c895tm91f8+5km91w//pudpvdv/pgfoq+hrpxmjumyr+jfte1l4qw9ynegxgrm8vuwt/iomqe3hm+ybqd8f0t7vvtbn/d8hp+czvkitfyp//u/3vvivp/pvveeydukca99d8tz7yzr4gwdivqd4adxsvwf0a/idpz3qqz/4ad9sad+kv/rzqz20fwfsa/zdvxwe/+r7g1wdaijc/yk/vpobxkmyzr4vhgggot9/agaiynhwiycgdgx463er40uzgrei7ngky0iridf28njjoeh/zgo+8vqilbmljkumlhgtgekd/nd2lcizz7pxq4eeo+dqb48evqjucrpltbqr6+d5thov6014zsqqflht/2epnfa6gioju4djjgpzsivz8iffhzkzqm1sf2pajd0chsuo8ukjtj5aewrukboonwykzxkmedaoectrlpr7u+dcnhizdqyilxw4ysjagqs3rkmske29eknsuvwumenwmrtlefnkhz56snr8syk8c4wqlnyzu6fvuztnlfhm2wlhgyq1rvtmcobmk2kz+wnlxyrfgji5evsxirahto04qw9uii2viofp048cxezky5exe+0m/dllhdqnngs+aueccc5pygin2bgjctpwyyql13gzp7bejprrt5zm6ienixwsyb2jmghlixhu3a8z6udh6zrmzuiom+48g4i7mtlkrp8h9b70hi3dclgmi74e4qtj9rprl5ncwroicfboa09iyzjzdyn41qfkac2p4ilaijaksjxvvifnnhnos4cpjaiyyod10kkhplysnmy6njpmlisbhbpqthhsgccwnegjiy6xmjmjrrlsu4gnsmkkydeldmtlueiqqaskmqw7blcnyfn0jdkagoorjcaabda24isesvrajwyyhpyxiokkyndfknpupi2qmqhqck4u5/inhao/oy2ocdizsfdexenqqkhs4c+3rez8skjzwiemnk66zewwyio6p6oni1pjrdettuzsedt7f6+lbacfpuj2akaqwrvxjdpfg1giiulau6v/hyubmsuttrya6peeegdd3yyv82qpmti5r0e1t4snwbu5hgecayhxwm6gyjwqngiika1ao6ynh+zwxjmzqhuz3uwzznz25xxxak7iivnkkuuwyodhxvb3vfkponillpquiiavqzd/ckmee0962mekwakbhjbgwhlxiweeiasktfgxwwo2dmick0rktq/skqjoggcelvri1nxkeq7kbbuevs6pidp4hjqdcwdocu4wdhwzv6ggmgnltrnwzks58bydg8kjt59nj5pjo5kd55pnnrlflhivfdwnificd+qpd1ronynqesatqlh+b4yxy6aykucmfctu9v4eo5mlj1ep/5uknepi1cmab1j5iiigjpnwdwe22huwsofaxosqgrhp1azhcstdo+yaciysb5xjmoecdbxlsvdfkhrt6tgjp40lxxwlumucbye7nsunagsjohgqi7wovtavaehcfqlgkiwiobcjsnumkgei4snpmadttw8qkyiyje9i1gnfe2svgqhizwts8iqrqceziiwdgmbqhjskoyzdbqlx/ochocigjo7hqgwlg0f4ofyak4bmctpwbolk5a0zhenqwqkkknyxrc196tod9bnhmlqqv9qcjrvawjcmgq4ulch8/nbfehnhikppxhaz8y4tbmglswhhsvwyq0xyyoywjiirgp+appdkxgpqhyoizlpb8sjznk6y8iwnaq/zmhyu8zeefunpxxfrlriqpimvbbgcd+drhktsiamukjkyammxou2rct4qphfh58vvjcnfktpszrquwhtxjeniilhjelrgf8gijkkzl+qewwumrcmwxcbgmhhhcz9gbuveg0cwyhwmyaajj/ycaf8a4auumgpmmydkpk3ypfzymhmsgccjxia2ujaweloyahs+ibe7eqjwrhjaa6wblpudw5qpg8cqjeirmsxurwn4skjg8bumfkv8cgpa5swntdmrkypbm5bqdseo4igmqd1rfadwutjr3mwh6yajmptgndumy4hlowf/o93ji3qizjk2+ccrece4fwsjfkqdzzdeyb6ljgqexkicq8rgjmri0ot9tm96wjejv7gcpab84dyooyw2sckheooeabzbjmtcjn7vqcaxqtu+xhbshgyagheoola2zikhhuebkh75y44dah34i5+zkgcoji4jgtawrjwisbobmxffaytwxjx2kmklsaucc8y4ysvbc0hdfdggqiwwkapgpeuhxiaj0mqbdd3eohyltbowfisneeylcgtnt1qr1m9nrfuwridr2poqsvboywfvmeu5l9rpqhccguyyrjeacsbvtgmaykawvvsajnfgghgubyrdfesur0c2bzzgbwdd/2nf06qjzjqnh4joiw5iximaxphigu2tdi9nzkm9rdmge2thnjolq3jkmjjfacduskizrkgakltbcluyrratkiuc57govqtifs+grqmnr1+v8guebjgc4bpxxulm0mhimpultwhcpns3u5tmlitcy4pcpkn6dkogax6hxw54kzgzdzyysys0bzqdhebghv1liw4ydgupo+bfn1pxdtuzzmdjunhmtitryrgmzqy504fo44p3ka6vbf5gnj4rgdl0wuvjwko4y4umog61qyq6h1phwys5ls2p47gflvkriqpjghxpidedj8zcdknufosaril64iuhjieqkdyu8foozf8qfwiegjjdk4ntxbstzbsuiwt0/nwibwztg+jkbtgyui1rvinz1xjaolrrdm544xhpbgqulpgaa6ejhwnqasjqgy54xanzl80cguoxk8malgjwcmajn/wn+hrrfvbdkisg5a1qlpbyed7tmdakuhum11zb6euqeihhbwvds94chyxkmwoklw0dvjh4qrficvlsmsbedfwceuwtsbghkyt4qx+c3n1e/oepktyywdmxc5sfwrug5eqmboeutngxkotibpxk8w1idceircjen9jxjpohcf3hyiyw1mgmlw5rsy0ojtxcgvepg6mzzgdzso7bjnjc4hiehsd+/deoa2d/lsl4o3awuegmasxrzfpszdra0q3mkaulxnzatddaikup4xq0ihvwisekvkiauawaxsy67nfzmk0wmu58cc8bje9li/hrwiu0lhsoepznkok4xoz5maiga2l2uv7pfliae0begq2qflkuj2wl13jhemj7mibe04jjv0ejsigcgy73umow+bzb2iyzvhxtg1vhcpk48lsulq5vomnylawhn/w+jbibzu59ccc0nkenqw+yf6yofde+wyclusw1gieyjmk0sijqgukbzoewaueywghieqhigmelraezncgrziewjkhuaofoikfcsi/lzgeooo7uxqmo5gquwmwcwkep/2zuegwvetzhbnkqcobac/jpydzbkvodtmru5nsne2yiebbqqaig1+wgcqbaoybmc6batz7tvezvzskbg9bbvbzifijacvqddqpb0v4qtb4hhmhhi9qvhlyh+zirwhtihlzhfuphhcyjfuwbpqlvda+es7rktedn+gqwzmamzpybhcyhgbrbf3yhf+kufwibao/bfjzgfn7hf3obgvrhfehn8jrqbddom5igezjp8z7wv87bfjilfwrv9g7beb5gclyjcqlvtyaaejlphlqgemtknyyaephg+e7o6cljc5jgb3yg+liacqzawscbf6kgcymgcrrictleg5ahgliog//ayqyc4duyqrjfyrp6yrpkw93uqzscywayaq3lcbq4gdaezxy6wrmwxquu0cncxe2cwb0kcyvilxy64rggbivsphhc4xgephuyashzwrtiirzawrnayrfbwfeqzx0kbwfbarzkrdq60j2wabiiydnsgqm7jsbgispyq5cqaegoarpsqaqmgaadygigoav1t9j+4pdwow8gyfhe6bmzirgebwgairg4yaqcaecayqhgevxysnpggru0qru2gruqkhhe0u12yagg7iu+osq/rbuiifqib+rgpxnm4dtarwdecysagqqowasywvvcxu1coxv8sovaqu66yrrudodewrp/xdekpaen8zd9foez0g4cgkeilw0zhaecksswsgetklpg5ei4jdivhk8wwkewrbi0hytpmarw0oexpgedtaevk24x+eaqhkyjbjar/gdouayqcc4rooaye8h2bi5rkmeqach6nnal+id5coeytujzrhidds5zak5kumebuoeb1geeygebgufnvsmuomwrv+zzweebjtiimieqhyedwbnbsiayjjalgkecooinoc8kgqcbwfhtvifovkxz/fajtpa/lyavbezokoeywliwjkhpimezjueyjccwfshxkgeyjbixa0g4fkhuziev4gi2wohintlzxseswu/oyiytsmet//zjrfmaniubdzqg14doj1kbej5s5pymrkwoevckj6ev+vqadxxheyqhfqyqg7qvhmqbheyhhlzkfsqbdbthgezbadrhg5blinhqhkabc8ahlcfbfqyacbiapdnbg5zbgmybgelxg7pkhaypghbag5bhi8zgkzwgcscf6ujbh9/0dagoqmwhelqq/icufwltgm6hg+zqturhermyfojbeh0vhi6hisxyfxrqawcbfnybfi6tgmtbqkxp45sgczybeogar5oveiqta47ueihnshkxvqlk5ncud2yt6io0cg0beogaj6drehjohgqhaisbgfjsg8ibhirbgpqudidcmp+2wvmxwdu6qqiuqakywd8u0n7e8rgioqugaamgoelyodylcyqt1iu66hy6gs/jwrz4d0ekoskk7bjmgr3qqv69yd6nqqpnkgq08tx0jgi6exzobwkw4rfewr80yrvwyrziwwljksebkggpwrkavdljarzcthca8xueio5euxbcgregdodqmhg+aaz+ybbolqzxla/oopzolgtszrrafucogq+cljytgrpwyvvx7gwldfaolsp/orzuyrqairumuj3llh3gzxuyqfuq0b3myr7uarq2sf6pyqvaqaqk4bjza1egjhw4ywv/fugoqkr/lwuizaxocjpdsj/78rr+rgd/wceuhqap7cojrkbxqefgveexlsebnofizwebzoehwyeefaewjpmunefbcmftmryvjlew3hr8lvsdxckdtmfmd6esjpmq5oakrqan6gan2qanbqeyhxb2aiep6mbmosedooeqbo8p6san2man6gbnb4frgpyff3zpueyxti9qj6eqwfm0/gwdwmfrk9qc1kfdv42lwqersialfusweiebukfkpdc/3jbm0ien7hdawurz3bfggsayruhakiccyqbbkgqu4acz3e+yeqg9hueujnmvjiehz2gbjweemvyykehwzuexirqz0m5zameymzywakeg0yer5ubhokbmzveh/4kwduogdvladnlthdcgdmkxdugaeexhexjhegbxdxbxdekghvkgbooxnlmxbonqfhdtxznfml5yh1/pk+xvbzn0bk1ohlzggflbgwyagsiwhbjhaazgg4tpx8osjcrcps3bhfqvhdq4janyubxk2z6n/scquirsckzhg/wxoqu4gy5bgeiwfqa1fnybyn0hfxxagc44fvtsfnkhajm4srekfu7huy03y38bq/qadg6hc6qac9zadtdgyj4sehwxdzbhe0azdgzbhwd4df6a8/5aliowd1g4d4kwespth1kskop0uxqbgdhwoq9ahaxtagzgarxbgw5lbkhnma6e8f84zg7biwu14rppgrzcqqg2or6ccueuxdp4oam+yrnuwr261hhmyr7cytrhvu6wka0d1gzmo+jsam6h6rvisro8obycnmr9yrzmwrh8qrj/orzs4ruab45+orik4rfc0bgeobem4xin8xgaqztzgizndw3woek4aakigrgsdjzxfmczoat5ia7cightl5nr7wvvuq50erm+uzu3ywnnghbpibgobhzqyr6mwr3iwuohubyyiru6ax2i2yqkgamyqxskoacms3ko0husmhzu4vnvors4b0pmgkciyqzeyru0irviaroeghqofko5hyr6euofdp3ef/wsvw/pzlmyorb/iqeksyehlrdan5udhkey+vqpqrawi2ezdplxc2evtggwg7ipjrena1iubfgwltb4b0gla6+kzxyqspoo4qcmgqetmnezszoqagg0muewbgwtedp2zxew6watrkebcmeeqlibymexuk4czvqydkwae+sxwqeculydltqbsmb9pfl7prsmw61k1+ebeabss7twqhk6qtjjas3bgejkvajt4uekgwh8mgg6waavzcezhlyzspqyfjtj/toeiniwy2eb8nswficbmcextohaz+eqkzzcn+gjaxhnb7ag+0chhnak+kan8kclk5crhhbdb0f2u1oraig0oy8rqptm+wat/xaistugpmupd3z3dt5hatybgdksxdmus78tquldtbtempd0g5puhbjh36ihgtdqg6hsxrvhqrpborfuw2dbc8cgfngrfpi8dzffcgyhk0hkbsfsxmub/niaywoshcqyhjzhf6cwuhsyy5d1ok3usm0bfk5bgp7bfybzfd5hzknwsknhfxihs1/alv8actxef4lxejbhebacd4zxdye3pgcbe24wtrubntcbeqjbxxf26oball9wxnvatgmbafiwd6lzipm8hdsmqm/hg9qbwn2hadchko0phg5hhhyaq8zhjvgnhbrghrzhggxa+9shc7lgc7hafrcag2xmjgmtw/8m44ymjajsuzioqrtab6gm5xduvbiy4ros93kl4tar0+uo4alvwa+biwmbwxgy0mitfnmtvklx4nnxmw5ilw/kphjegrux3xi3wcivgapqevdjqdp5obkuyau2yapkydhrymuxirhoqkwhkasyyyxjya1aaauhubb0wtqnlhvqrsjsbbziyqkc1by8rbsmxrvcqqk8awl9wclgyrvkwwvlyvm8chu4af2nqbmmqgtvzicrqacakwacbwcaib2efvnalwk9gxhgiyklwremyz1nwr1igrlcix2nhbgr8hrbgzefgihj3z8x8reqycst1rmpgq5++gzr2bmxgrq0ng7/vgbdz1im7p0fmqetojpvuuamumchytrfzzcxybqiugbnrtl0p9qbgmh6jmlklvobmjqn5kqz1hgt09a0/tykg+c5kulrmeeqy6eb7lmujrek2mazekacpvjadahkjnwqkdyyxmpqhyz/ns+hdkmzvh4escexcbobfdkbwcedpmfyjawku3rus2essgeht6gvkdnsj9fx1ay1mt38ctyqbhtxbr8ttv+wr4alinzttzousjwqiiolcmejeto0zzpojxelaaikfz5r1srcca3cn2dvkcapegwyompzii3bxg0cphgaxqlz16abuhdhwiezvqwyqnddfpnlue4avg7b/8yp29bnmzhx4bhaqrilxif5cgxw+yygaudth925u8mn27ap2rthbjdundz06uctoyeuwrxrb5o1m2xml69zagdhpdxrfcxysab5iou31jjkpxoje1bs2lffrqr/+tws2zdv3gcss8qn8h9mgylt4toikwzgph4dw9slsh86dnrk2yyj1ka1gswr4qkkszaua+reuzszez/lxljy+dkf4cyj856wq1lkcpgrsngmglbsijdv385tbeeontbm4majm8vmsjagsoitnjo9zrdlxowhkcfs05apvlywoqeo2q148az5sycaaobki8w88zhgddvsxgnge+6ui5u23yzjt/9saqwztjjiolmgo7x8isxcagnjvc/grgimgslemssqbcucjtpr+bjilm2ag4xgzghgddhiwnodf2iuvbafjfswgx9tthhzibxi0kcfgzbwrx2zyyjjlizumykxlwfcccb0rbfhhhqmguvudmawxrrskmfha+9twww5xhthbsfxzjffk+jlznkp8icjjtncilandvgqrx8vvabsc2pffaoponmkkie5l4wtrbfq2mcglyvdgw47/p0jadjqqmoooduoe1wp7kjgiwisiiaort6ma49m4fb3tdfdgnbnlbxk9ddfzncyilrthwgmwrnk4o4wq6yycewafqpoosn0mhf/kelwygptl/fr5zmymljuqxg0uudbdgxyybrndnjlaq2kcguhy5zml2mbrizmkydgngdsxmzrlzm4tqookw6xoqr9rjsg6zckiboop+fmpell27asxbrcdngfo1rwwqlw8gzjjgllpayojxv70ughsvihedqjmzavnuquwfhuwirwtvqybbnmos8plk5h3shi3wlebbmmxocr9oszivocy1+wge3jx2g5m0tfguxdfluwkbkli2dyi29l8pibnyb/7mzbhzetgxm7r95lybh9rlgbvhvfuqknkpe9cb2annjhk4cwfa9zqmkiyjc+fkpysofwdma5sudldjrdnfke/xjsffjii15a4sghodjyutnltafooumouqubbiwxbbsltyo8poeu2ozgi+xkzuhwjz2vmozkzb04zvjpu0idyxjlk4s1gkw0dp0lfivi/ouxugg7m8+izdgzsy7rtvt2juuehyymbkn5icuhiw9+wwywbdcmea2hd5zwx2qidqtatyivjcgeiapsh8gcajkb6iyc5sgnzcydhdxwbjxy0qcbmcn6ouoytl4hrkherxucueiqdscddi1ddl6qqy2qgh6niwmmrshc8iixbhhauctfgicaphavb4jdoyyzytngyzjvsiub6fcdttibjm2uw2k5+qy4gicdiwrcfshoo/840lgk8bxmglwamxwjy8e5xkiyxeago9jilgocqlxtumicdhgfkhzisphaa7zqzhm/xyyrrahfvaiuh8uqbkti0k0e3mwvp/qbekbgxrzohjpevkiz7qcinsoxaxdizrvoojoqxzgoqcvfhnnhzdpikq1tykiilrdgthgqdl6wqhw04uyzj+cntkwbcenrginagq5jsoaohnfigaeis1yeowmu2ek4kna0niqjhczchlwmwhalemegn2ace6igb1r4abelmfytwhgmvstimjwsrweeqrwcqc8wsdifxd4ri9vmoqpeqaiucdgiogrqk3zoaxf6ocsnkmzenbddmxb/oybs9i8ueiotgzkzqmrvyhoawcqmklgkuncifq9saduayg50cksn5yjqodybgkr4jdrnmbceuhgmvjfggppobknc4q2mlogakcravwrrhuawgruwvibpzqgopibdhmzuidiskaqedcekurdvrxgjqxbobath2wynkmadhacabspqaq1oiaqv4macqpcgldlhd/btrrbbmkhhdqmxhjlibekkxr/s5qul+gqkdkjdwdaziiqhqtsolkcrukozfjxmxqqabyecdi7bwjqomghftmxhdgywizgny4zvzogn6injhhw92q4e4i9vugubrypqoyyhaaqcra9hfnue2jmp/wlaak3bfby7wpuyb8tkhhhngmnipot4vkejdrwhqiagjh+xv0ho8ayxqjcfhrwhbaharwhcga98agefhjwcdwyqrlbiqhbewgc6lpsly4vjhajvn7je1yqd4wu+fypkzf7abtcaoqhcgkmkc5ozqwaieywykcewuyrrpnayecgkwuqxdmcqafutiiczs+pmviquqn0ohzqqko1gcimcluonn5jhqnk4wxc4oy44ooktpcmoi+yojxekybvzlimzzvzvnwobaw+u4jw0g8jesqymsvvnivqwxzz8astuygikuyhcdrccg0tjywurwecohccew+lgbjygqhcgmaqcgv8cglkoxthyuw5zkmldsri1jthdby7iqlrj0iqx2gcjiayenidwakgjkwguugekklgxzqresedcwk2yycqmzbep42hzadtgsxkh10r4rcmd04jzpmzbjgnmdcnvxcpjjsynm2rkde5mijeo0t6jfaq45cghcaehdn8a4agd6ajwhaufo0/bplzqozvvuzyguoedr2ovnatjg104oh8mz0co4aahfjhg4vj4wacmiwmjgoegm7j0emzgi3o44kidhrvvxzeieyeoegdiilvutayxvge+c6gmzgbhmpshbasr0w0es9mgpititlp4w44zf4snt6czqknhd7boxnac1b7/3odfznibqen+iyvetrc3sdipcl9iugrbqzemoxvmsmolixghtbagcv1tqd9vogizrbaew3ajgzgtqaout6tw+nhgificahbbgoyrnugktnccd4zgfer64zayqrhgm9edvhizxeghk+rfmiiz+7ooxapkxorafnxac73pjuaofrgaq6khw7dzixldrks0isphiuqwcbgvt4/jhfmrnzimqw42d8mc1xjakgwfxw/rzbzfapge1bfmnfakixb7xjqhf71ewembomgek1iriuywohbv8iqrhhffw0gxi0ajtozoj8mfjyedaqgac/dbciw1ea6xabh3eadmah+wapo3/3edh3lw8aigmakvgc8pxvuvqhrwkkckwqehcag2dsshwav1vzeozssrqzc6hjjfaah8mdbosgmlmbxeiapziavsaenmpdhw0retmq9af0bhfuptovcyarycmw7cucakybzyjyfs5x1xdv96znbdkhtj50zdwaclirvf9w3imghmctpdrr1gkvx41qvznqzyyag7wah5waibca8ssal5oaidoiagaakqb4crvgouvnkdnwrhmmob0qreceejpyiysugv4dh8mww/mxoqbtib8wx1uxehwyrgsglklrojxqbbobbr93vawq3zcrpnjkxnxbjssg1wfrmwkg7s8btq0p8muqfm5bbegxfu0szcu4g83derajbu4yaszrapt8in08cfpzmn/me0zyqv67aykzinu/giy0cmzcapgnajhpablhapaqaeoychi1eaoeb4kbccjib5gcdxhdc6ojmj6+ajf6bj9ziigwqmplaji5uighbk95imfcgwddcfnpyzisalveqfdvdiwfaotbg96xaognen2ramkkj9rweo8eaacva0x1qhananq6irycv0uugaeqay5sya6rcfozf8ssht8fahpnnl/nemt8aaj/k0zjhk1kerakbev1io1umocmajy2agtsbvxngpgtcg+oap9zchdkgc+ncha2iodtf/aosierendzjwh5v2ezhwida3ki7icabacrurgxudl8a2cyntbl3abxmglxb0cjvgdbiwdm+gcmwgo0xacgrypu0kdiykrrlrcfyqdf9xbe6giidxoxwban5gfedhgfmxkqowhu1ukhdivebfts+zk1uwq9dzz/ogdslqah5edwc4kv8me0reddradl4wd5aaa3kabmzqksqold5oarxglf1hhwhylqpiadnaaam2hwjojpegj0rgcwxgby1qcytqcbxec8mhairwgvryijzal6xrbvowgvzsbjiqckxqda3kdtcqpkagbi0ams1zdtuwdvmkdsbapk1tcn/qmd7g/wy1bdxn8a3t0gxf5kxaxdqksgyksu4bakbvkexr8w1njqhuta1nrh3qdm7mscrgyzluqbfkmshreulqaguw4adyyay9obtgqama4a9pujx40h9zygcfjyb4mgimnp0haal4caiomgmx8aixsam7kglt2gnmuakhvjcbpeqscdivsw+vui8bdgzemjjcgarjef+persma3dxmbkuearukawrsaxzahbriw7mqbtkkbg/glxu0tr8fd2oakzrnq1chq7ushzumag5kii55g2tgn+zvabbfxa9iho9wl7usw2qiaehegy90ap+ckvnckpfuap+sa9u+yzakod1aifpcf+dioekjieoixacngcwlfzel0cehpkiwlijviulyhqzfubrizaihsilm0airda1coiawlbo1trctbrw3pbk3makupaf7ek69ovft3ka8kmoy0aozqaqxoafxrcbvkgrg9kdg8os3dbf/wuu3fars2k0qpivxhdozhg0i8ersrug67ar1pds/lahancldmsgdzcgy1agpycwobqq+1cv/seh98bg54iox5mkbozgh5ap+sabndca47edsubxy/aicisapqabheaifccso1sjldainvanwqyoa5ant7jetjko6xao0ouavaafwtccffmetmbo1vcbjlemwnatzpal0nd/dhdsbejgbrchrx7je8egmb/ixnffda0kaqoyvdb5hd6xe+c0rdlkrpdqixzpxxhrbtjzcepvqmbwlgxwsemvva7rsbvrqvkaqwegq0uqsidwatj5akk6csfgcwxzq5uhrjjwa1ywu5uacfwicd3lcy3wcokgdcvgiogqbis0dooqoufwbi3qdleqb1pabcetbunqbliwfehavzscdthhmfwldavguxohbdwfo3s2dscqdwuqx0vlgcvrdorwes9ynu2kvp7axjcknffmvlhmdtipfruhsktkbl4qv6qalqeie/jmifclxarkqjvkox3qhhwwjh8lglr6jkfkejjl/44ivpauvwszvjygyqmcmggsaay2qizeka3fua7e8au+8ccsohhvlavksau8nwxxzatneawnwbtww4rstrrtqbbbulrfqavikdjceczs93xj4a38oac7gtukisxtdv9vbcdpqmpna76ukwhqcl7cgfttfhpwyaateavuikm8ol86er8zc12kw5wbwr8a0krjmq8mekslzodtxmbikqu3knhvgqigujycd2ltqsdcxkoaka7odkiy0v87ca+0swuzeawhcaa8oq1robxbxmbiqazc9ts7ouxciazbqazscatqfmujsn3luadb0axgzunbuawskl3gglztnslbuwzcgp8w82c+0cdlgaennizf0wyp6cantfcqv7vfxgyqd4u/4uvgsqeuxuycelujzscxyulg/vd/j0daiiurdqfhjqurfvihnyad4yhomnae7+adrxt1vvggbfag6+anbsaox4bv8zabyrwnhsoowtvljdfoshay7rknbgim7iblo/mntqaipocou5bvsvbk6laasvzfy0xdsvkmvkko5adf0gbvxva92jcngjfte7cd8fu7jbgfcbvxpmdsprrgxoywirsgyuyw8tsphrcjatcnahyvcsjg1yyy0nlofgcpmgscvaqiltfonkctwcermgldzba7r8enr1t2rplg6xcg0+d/dnywvcvacecrcazgc9bqdbqhzd3ibv+qbsutj7pdbvktac3jvlb0dvdstrvcdfbxc3tabtw1c/maxd0qewoydafbmxp5z/rfv3svbe2aoxqbvxhbzperuplrdzcnaf2so9b8cwgcalj5f0fn2ozhcen9dwf2ascwspq3a4kiavkaav6wetx6dnaqzkbdriuxesvvk+dadmkg0lccdd4adavwdbtp1hzhvv7ajywjc2ivbubuzprsaogqel42dtpaijgxs1trdysgmosgddaadum3ddzbe91qqgvtgxpf2prlbc2ssq5rxfilxcocxmfcqv7adzitvxhbxvywd5ew/wv64lhzymakb9skj50r8jwntz1jmbji7blfmamqjgm4zabhknvqjnvzqbmcma7q4brooq7k8btd4kwjea8y8q2eqmjecazucseonansdvzxea+jyrn8n9cjac/cqay0wwu07k7lnd7hka1hkqsqaazh7gutfqvwmn+hayebfqx6wyghk9nktdkoyw/9snkxrewrwg+fvqsgga8s4oyl3udnmm0slnf8+aflybkujoht+gi2objvi3wakdprunenjl0kva4/s7rb9hvcsavckfwmwqo7nypnpiluy0y7oq18r8ujuhlbmazvibbvkanntg3m3cjgwazuaae7cazdmv/lvxae9map/ec/piqxatds/d3fmu2mzgzm4euwaedmiju4phrguamjbp7zyqng97dgpu3adz7hql3hzukerbdol/bytzaeogadilvbaicggsq9wqli1qmgxpv1neaflcbc1lb3udbirvnemw46wfquvecyjqor9humqmslsohdxpy+otueazagp7apzn7ftzauyr7tsnxrpdrtccvu/adx/ac4xijsyozz/nspam6vwdmczint6hja00lxczayvwppqydhlycdohadfiyfmipc8/orwibwznqobiam1nelakalstqbttjlbtu6yofoy7tp2kayvtegbmafuxaesld/f7zszawiv2wwczuacmmabgroqmyq5hdb5cpu7bnfkvlmsbbco4rrbhvfd6lkxjxa0xk/o1pzhgf+aain53e+7qfseamgsn54a4d42o1f89eezhsq8zkux2n3buoau+swkk2bkerzek2/dmeujd8wbixzkbqvwpyqtqigdf8h+g2qaatabfyct/tqd2fwa8tza1bz2xef08azzbys7l4flfa98cspuhl/7hu/vzvqaqxo01gppm5j+g8mlix/svna2rtwlof4qztqbrywfow0hfkybs9ee4msvvpxj0pvqjwptpgvdjakbo+km4tsc9dgwezdhqdxjvu3iqwtnems/wrvgjrozpjy5w9adwev/fxw569irqaabhtsufhkr5espxbm6a9ejx5mxkbkcobid3gan4lecy/epgu7oorjcs/apxwr8qlamk/puqznc+tit2if1hw5vuddiu/db10cooyqccogjcafc+4oywsymxdgwp2db3jct4hevthlnrcbn752w4ktn+7coghjvn27xk6bsypforbheyviefnaoburpm7byhdflhxwuuvzmnpofkjkf1hmtiw2b4lkgjukzzalm67w+njmv35mmrb+6fekspm4/fhtcgkxchxca7cyejrpu+rvrefbulqfdrxhx5bdsynhepep+n007pebs/+9fe1+cxt4xdqp37zb8zuh2zzkjcsoiciucqtazhtttgfhahg2cwkkkubt4od6feddja1c6iehlnqqyaknbjoopa+dg2leiyyyw6oldoopnufaalejlhdqp55leklbhhvuyyeffjrs4tohrznkkqw+yecfftjwjgiyjpmhshliemkwc85jbxl0pplmab7g+0uwdoicwjtstclmmwug0qavkqkqpzttvannrry4cscdbshx4oorhlqiih/s+geffjgegj8njnioiw8f6kgj4lwulqbabgiuiotsaokis4cbcbbinu1nupd6sc4cdpglych8tjhknycp02diio3esqn/jbvzzgybzgbwyirscyybu9wsdmt1igvnwg3yakyyd8jzyxx1zcnhmcp6oqfzbaqawshpkhg0jereoikfftrfscskwkorj3kt9s22lmqq9nemzhiurberdyk2td/yp1sz5ixrh558okeohoustjpzp7o1qeisougqrubyeqwbxaj2bhmg4kgjr1xzbx6vev5hzr26ywaecrdqjq9ffulfhw68asscemdzppsqhcxcisf2gjsefkix9xinlkwbttocjum2eqm2kf8zmmic4jquolrqqksa7mb/fhsxyxn9axoxfrpu9r6jpko4yuqowirjq7rk0qtd/t7fif+b/fgg/3r/8o2idb6xyxu68hl82wby8oswcqzycarrotjhcvtq6a0nhtjabzufsg1ua9lyiultaxyyamcpilwxcss4tantsm2ssvjqlsxy4lu3nlwjhtc40e0phiao7rrthrjivkhqbrsmazdcclfsknwjjwxh4xxxooop8bbq6svniswapxsvqoa/mh7qqiwehgpuij56covh3rfon90oegifdwkqjekoiaef0a8f+oajfbmbb+7hopdipb/aarrtzfc2tffwbrlxgvhwhhxvoqafrqqacsq2sedbjzp6mxt2+hawwvmke75y0heggqtlagmd6xhfz8rbgivaixw8qiit3v/ea3/qryfpmbq/flabcsgjh0diaz+oscgadceiejedao22a4na7im8qikpstup0aghb6uyqxroarucmqejjopd73xxipkkto/zys2gwcivepajeseim49wgbqlicwrqzqvc5vilcltltsdo+h2qhyyyf1whqjdfbo0ciuqhc0iuuafg03zth00mco84yfo9pcghxwnrknqawh0wlliheendalh/+qgxwv1iw39wmlnroqotqxnrwpd1nekibdfcnka8qjhcnabghpoiedguqekgvlisqrjklmxxweo9xwp2yaivtqkykbuqeqb4aps0fygihcjepgbda08nth3mvd/xmhda8frxz0g2giqgm8hsyhcrkmqqaagoh6oimiqpfcptg3zbxrgh+sifbzqwqmuj3hexdyvmglm5cvf+yblqmnnelpwhzfiackfywjwjgue5dxkoatzzqwgsreyrif34hksgucbc1yyahoy4aq/hgjd/kihhh7qv+pieq39a0iurobppauhi2g4ahhauoyyueh/axichh66kcbk4tz8eaeyszjszw6si/cahcx84adlwgm2v5mmrlyy2k8582s03raoseg2fejooxn7zgyjkdsl4corr8phv8bcqxvaygiakyotohdmgfzmj4barz88sc45dpmmp+bigybp1ic8/6e3bpvnp87wbaqoiqk8uegajjpmksihmzlsjh8fyqk5bfytlgdhwh6xwccu1iu1awzctlii3vsmpjijrfjw1zwequyzqoxsry6ejxya4ctjjyqxphmjjmi0ngiqwyuuwy+mflw1pnjjgesggvzulakgo4c86lguuqugjkfgqrtenaqd0bxauuqhpx7wag/s8vovosmoudpds6rou+46bds/vhn4ejexkqnyg8ubojkabbsq+cs8nndtba7abd3iau+rgolmxvc6ntwkezi3a0icoqlpocu9fiocp2lgn7tjwxh2azls/aahu4zodmdgild4wb/0mku5xqaborwbbv898igh5eaqqwpghxri7u/ojvhlwaisqijxpmr0tee4asy2dsmgvmygmngnagiobygsoqluwimnqmajb0qqph2soecsmae+okikjaha1fb1slksipvahbcjsxhcbl/qg4zwa4pp40fjkiqkrbaggadjxxkgoqo0maiux2scphvyzw3m+qwoqech5sbfocrkayh+hu40pymq8gupkslgjg9ym5s0bim19m5vveu8j0dciztarqzd4rszgmlf8qjap0qggz5wiecoiwptvmdczcy6h6qnqhlwhkh6mfb0p9gqh+i40be4oddwiaitznypezrqa2c4gw504nvxrpxsvbh/xxjqsw9+7nmyaeajg7mlmnl0xayftmnvmfutfs36ns+opqlbhu6zurredrrjkm7wc0i4bbsqmiqcvfagtkjydgwoqrk6qopuouceqaanq5nsscezaye80ierpbzlfqtun3vhsbl6wwirikdoq2ic/uoe4h5mnapooacmymdsmlihdafrrejs0an+fm6foeejhpbhllas7ksp8iqnqahj2bgmmsn6uutv39iocsauoxgejaobjzmuwhwfaeuzcjgkubavfcvr98la8un+icb5oypbrhbo6nhcwkg8gl4ampanjzrmq74ur4ipqi8mkcejuv1zx/uh4sgmtwu/iogt/8xqbt8caytyfnndskdc+hxqbbefeyp/dzixff0rhsietmieqti53xenf+ggpfs91xsum0apbyyeryaseaa9k3oe2fmzudcd2gqfzzspueajldka43ob5kchhfs+5muy6xapjlcezsmn3magx+mhd+abjua8obael4imkaizhzgckfobibqyousbjvadunocnggzwvkbmzcr49m21ka2qzkbq/kxegeacgs9rii0tcgdkya9/psxxfi67jrd2zcdtgge3pm3rhsfacgeuembatcpmsi0usiemasalwafnmyerzcjesabesg4uikbihcvr9khtaub/9ibm7ack8g10p+zmhxzucmgah1yistcqh4ukyjkoysmkpjxgsp4atk4gzi4gxplaxj4oskdsgpaddo4qfsrfh5wjhc5quywhekwnegsgtdbmd1qnec7q7+imklwwh9lkvgwhedgg0mahdl4vywwrdiqbvwwhezobe+gwelwdddlhekarlawfqeorjxcxotdrcvzrbw4askyjcdygzawpjcgkckcor+ghym4mojcinvzah60ah04gjolwu6dqdtqgyfqjwfbionbhvjqn4z4ooeksh2immqcak5rbgbekuigb3rlwjo0mjq6dytiheqdidiaxkkixaojhv+mbd8yhtasic97bg/0xkz/ubk2jmddawvxairqobs20lpipa7jw5ejm7sfcr59yihuebzwqiuhc4eukmktwi1/udkm+wed0ailcqu5iax75ieneig8+gexuc3a0wfcmrtjo0ihaih1mtomnlb9ykiucczqcd3ra4xawrfr7ad/27ns6yvzekmnolqt9cpa4jce5d0/qc5p2drl4d3cxdhcm6l1aivcyinhge3r2719a8gmginikimtnlo+9a0yaqbqqaenzbgtscsicqgicaf8wif5hiiy+dmr2ic6a4iyok5+gimoeiixqavdysa74gey8anu8ibduokxook2nm4fgaf+84fyaalpuswxgkwg/4glpuknjoohfmgiuia9ueaeofcenjrnm/cergsfogo4sbi9szeomewjtnegisgdp8a5v4chtbvo3em9acwsubgfmesr2pqisiiesqifdmq9mxgdanw9qhasldi32iydltralvez0ewagnobsrshokbrfohnexaci5ibsuabvmowj4iogqmthhrinpab0kicj3a/mwsjx/cbeugyf/gb4zkr8gsdj5otdskydekf9oqhjhob1naep0ipuiaet5ie2/u9uziecjqtfjmdvcbto5oihlcuphovm4dcfpghevaj3/adrpadl6afs9hqnsa5trusfyoer6gtb/rg03wfq/9bh9ichatja08awdnstxplux8zlafwyqasslf4vy7ohxftcanebzjaih0bzhsaj34ywrdgajskfiw7aslqgrjyv4g7ccxbfyzia1syg/45lzq4g+nhidhkaw/oh34yaya4iizgex8yj1iciob4pqrmbml0g0lwve3qhgqebdyotgg0ljlarzsgbdloirmshr+wodlajx4wlfsgbd2wbm8x1uaihfeqafbgawlvtqxrwj6cbfeasg08cu27lla4yj78qmosrtkdzx7jfznohewwzf9tmdoeahzoilaluvcvihdiursajw3oga3gh/56qcfqou3rgc4rfbcantucntt/yiijacau8qaroai3aim2+ohxvbeggcwmukjhogd7eyn/saeskbqgw9egjitb8wnyranbgtprekszcmbh2iduisu449ikarf/6frckj3rg4wamisthawp9bf7lasjvau1jccpjeln0eaprckqnc45amaae4qyskktrfcuwgczpvv/yimzpupzo1mujqoauieisecycfkreiewaiitbj0fuc2j0tamcfpusqilkip7czmoayiqpdqgob16icxkkwhqasjlcjqelaoeqan4oxt+kiefkaesgarufixb9ddnoitrgqxhkak2hawhoe+yc4g0gkbd8eugaalm0ugc/ewz//ryukhbc+rgcdtpriaes3cf+/xgaagfp/ce2asspwdbqudgjo1atdmdvwbqfwdaiqxa/rwfbu1wagadssaggh2kpycdqjhzh1lzz+ubdxhbbvmb8faa3rubh9ilitgcjzhfewgbdxmchfabl90hlkm/pq3s1jdwwikeutgmngkfv6dpmpadp0idm61flzkniywdglueedw0lnjbwkcduqgfeqaqxkmhdvsx/xgis/nlajmnfzidsrifazwerkaeuwdyrtaeczthrvg9+d3hdciedkbpanbbeaqaqx0fa05tvcgeu0vhdqu9cpwh2nyeb/0/adrvw+lyeqahvogac/+ag6hamxzi3bmkatiggaskgqhygotqrqdggsgoapfzacolkktlaiuiauh7aig8g3jltculpxwhh5xma+pkgx1qmqutvc+zqsbycdvssf+pysw2w98tlfeorddxgbswxj6ug1dasmvrq3nfhymfptzvhumgha1vbw/srm9kbcnyha4tlehwbeusawplg7galm78w451bvc4yi/guklwg3efh/1kq49fqywwtykfoacgbwsagvybago+2avotzxfarwwaik4r3oixrc40iigvirsidnalh3yadn4wanjattlcfbisdaibwjgbwiebhy1h1s4webd3nn+bae81omx0hb/aahzifrim8aryesfmk5ggifqggr7ex1rfp1armi0gagjzd+63daf/mf+rckglymxtdbw1yqonbtbgafy09s4amcszqv/c9rl+d/steoo/d21bgq/ibgyuqqookf7oirmdvubdyepofecsigj6yfs6rssgaebga8pogwvu4iy4ifb6c448yezsg6nytdegb1reau5sj91kbqorywxhr0ctgmzqend3eblqdbjnjspop1fauni2fbh1qn5ol3/atzly6ilmg31tifh4iq0fqxadue4civhgeaf9fgh9gfh5b2uujbqw2nq/yhd/kvl8ngai0wlto4ctgs4/sousor8/9lfangac8ihs1okpcihrkjgfdgbwmehizboiiazf8iasdoafjgp28eyknibjtibgcodfwujs7gfpuk4ocieumg6ahibmsudyrmaoyi9ivzqh7gepdaeh8jjdaqeabuef6ahtkgqfwibnajx2amep9jcr2aix9tihycnujenjagfafuequjjsgdyk9iin2zfuvxfup5nkjzklpoujzadc5te65jiedhrlco03jngsxa9cuxpeiicmogjenncu96rjkhgf/qa+tzrexqgnog7emagylcj8isu4kqdukc8zrxwfgowars/ypqhubcwnnces/gbzhwenaisutcdfb4edv8ehzkug69eilpygwjtb6uhaxxph8/xh7nkz92wjrw/pi0mbf8ubdruhcdpstlshb8tpmzc9sv2dxhobh8rblq0x0kozten13tlzfbgq3ombepahdwrnfnvixkwkz2kjktxbw3ybabyjbwkjq3i0r3l0usvgq7aow3pq0ojs3jfszkslq8lhyp8gihacu2gm8e6azrwbtlnjryh6tngbq3cs9qkztiwq2bsiwayupl7oi0edx9sl48ahtnogrfiyk7whhvwhveg4ebwy9m8z4dd2gx2vjyuhubcbzbwa1+s7beoyvkda3ifyltpyugy02gcbu/ot/w951gwgq5phuz/wq2qsg99slv88apwo5husgfonqhp5dhdefhjpjspmkyzxsutqoeuzbrgvwi4uz/62ydfrc1lkaqfcfd6sfnyi7yovdbc44etood9i9n9acamzkblpznpsxh60vlrirfasgp4fpa4cg80matnnmdvvc8nvfxr3d0b9mainy6zhaq2pamauo6pld7xpna/9oyxpwetolpmzuydbdtwohxl+aawoieurbwm2iop0icasagkb483kj4neiesycokpphlq4ncg+if09cwmynrebobugtc0gbybbeygixakonj+jxhkf4aw2jq6aftfgo0ad0gwgjeky82otzlwwhsl477/4qe+grbnzadrqvqp57fnwzjdqvgpfqeqiz+ttizrnndnvdyee80gdhdd96osjq0+eehr9coqmwaqzpkcyaaaqaovgtgr6iafx7n+lsiyn8ueczm5fohb6wkfc7zncbnlx+ogzoc4awyhecpeii0aejtr0cavgh6oeejrw6kuanqnbgksy6zfmjgyul4ro6gs10p+elnjlsoepymysfryq8qozomhflrd9ijeqhyjijujs2ommggquldl41gnchree7kbx+/oqlgewp0xl+kfvbajvqrivikizk8wxnfygckzppeglryqncjv6gyzto7cdwj0znwz3qkdx2os34sdf8slgnu6d+tohbckmakmzfnlpvrac+jshqxohzal0plsievxwb/qkogjsi5g+zo0q+odznfjyznc8zpkeiwlpgzhaoep8bo6i3scbqwylepubo09td9aytiylkoibqkpkhqu08ouunht4rmmpfqkiulwy9hacamolvp7imkkvzqa4ormzxrmrkaiikiiyiunokqjwtidyirikkjkkrfmmkkooocciinnhkajpa40msonaxnizkgybmkklpbkkkhk4dvvbm9+hngfww00aexxpxzrkgewrndrfboyaeij6s00nffyustttizl55c/idmgz/0oghggai0gizt+2xg1x1zqktrccshrpxufzcuue8ahifyrj3wslxugaaumlddkotnx5nopfzfuv0mnmkj/fhjvvl1pfegp6gmcky/hvhtcjahiukijplczhuqifcy1cun5mjki0zoeslbfjwsgsgeieklk8i9ss5ls942yrwqycfcqaa7

Zdjęcia bez atrybutu ALT

data:image/gif;base64,r0lgodlh0gdsapcaaaaaap///waaafgigugigtgigcgiglgigpiylf0mkvabi6gigjgignqykve2vygiglgvk5gyko42tprvbmgigfgigir/gegigdgigcgihutfss0yklm1udkmobgigony6dji2pjo+do1sagigbgykcgooojo+nfy6mbi2agygmjy2njo6oj4+bgqkcg6oebssggogag/ghrrlrkym67mtxungjedrlegyjrantfo2bg/gqg4cagocagycbgogcg4koj46a5xcsbaxrbocteflx2sdnu9ctvnl0s4dbg4cdjxcsrote5wmxgocgwsocg4gg/edzbpdzflomkwcpdyee9zcyg4cimzmcjypbz0m7/kx7zjdo+oc7ladxf3cstqnbk4ntrcledecdg4codgiigocbgycdg4gcgogdg4kpj44/jrdvfndfjsl/jwdmjgmeno2pfpt09mmelicpjycpjygng5helhiplrv/julss6ht3yvfjicnkschvqpoi4cbcmcfjignnnqpi4cjnvcug4cnjimoiocns1a8+scpi2hppja/iochbodokghtgoceg4gkqfpvo1syxsm6qryq5xcg1vlwbdwpkscfg4cjn4ts5ycpbrcnaqqegocpanisgycdgogi1pgfo4gpnvdrbqdfgocpkmq0o4lm1tmyxul/e7lhivcnbpdtgycegogprvmffqdy8vcpwradjzua4xcugyclfql1gogpi/rnnhwagenvgycnbqmpvxt9avdwgychgycpjqmdj+cigycpavepafk6gycjgychgigggggogycngycmgyclgyclfvtpgyci4wkxcylbgegkgdgjgegigbglaxlo/u0/gicogicngicmgiclgickgicjgicigichgicggicfgicpgygogygngygegicmgygdgicpexlsgicnivllgygprrt0gygbgicnjotdgygpvxbigygdkokpjo6pj4+ojo6njy2mfhxzg4ocgokbgygagicp///yh5baeaap8alaaaaadsaniaaaj/aasjhahpomfcbqdmkssgtazmkb6vmvpgisukgdmmswhfo0alzcai5ghf5biljkd2xmidbz1ufjrpihrjpqzjohfs0ipozrtbhoik9unuz9a3egwh1bntj1glrpvinsqv6rtdnjvwpxqvy6q3wn4ms0vkwkxktnwv64uoxs1k4mljfue37rhz6datgxdunf+/4oibawwsmbhx6+clo3foe0fika8ezoqqyqfhoea12xfxh+enh0fjbekspequfzestnkysro5fijrpgqz5yrnowxt2snoqtdfv4ejbbrvafwpyj1o/qmmkkywyn9k4ujjkbyup/xqmubuwjx383z9/2ixbx67y3hrqj/moc+8c33/jgsc7nz8woctr1smux9c/wyljbbmzjsb0rbdenbszxh9tpqbky1u0wmlscrde2igyglulhry00044eauicqc1zntud31w3jm7rrcufuvfzvykh5bnvzjgegfkg+e0ucqxiybidosucmmo72w08wvvcqtzztexbwoevixppdih8kxwdkmzrdmfvdsd45/zca0eeirlqgkgs0lkabnchpmrzw7qkzse2uucqzay0xoekcw8vaetlhfihuioylyilbfatxii4wufr1vsuxlk1oxkndvptzrp8tsb+zhhylkxpfhmdakokuv3hdttdewdv/d5dxfganorxpz9rdeiskmh2ccdskomokca0+y/jujiekyrdkdntsssgcsdiaukhvlhoqqg3yw9ce1fz5xxoyc0izticl+rcjxm/peik+lzorpvsyuj+o9jhocvb78zggginar5qyhbmybsthzeikef+de6s3d3thdtxrifpnnrlnu6l6y52ts5tilzuexsxrtp2xbkbhijg90sjtty0mmcdbjttqh80b3nhguhor2ag6ilrolffrhfa1bbyscsps+qwtll9fla/yfu2bo8yuya6xbrx15bjlhg/resqyxuzqyjwtmvmfgxb64g4453dx88zsh3ur3flvetfe69mn/wexi9rentjjn6kxszc72wiobclombcvrjqhnnn3i6edff/pwbmzl1prouircv2m7vzh9bnjcl3juuprytxpqvxebsfjctdgff1n00cyafuxchyrv8jhhkceyow4zztwtjzflsdvm3lxs5vfhf2ezmwo8wuopr3cbjk464pfn2oagpwmggt082+dj7emelq95dvrinyoloxmtg5jl04dat9x0vfz60vakjzvfgdbetwvdt5bcii2aarf6miimdmgio3jbc3p4gxeumac6jkirgybfkrrjdnjigb3d6iuc5teadjhdbhzlz67eiuo83qv77jgdmg4osrx0cs/i61jk/xk3oasb630kiho1hregllwow4+axekucr9xxcrd5wprh5kirweqryhayrgmemkbay4qdgdgcvkosog7taemx5gcirlxht4yagsseamy6jc1pwdid3/oqx8yqypdfoixdadfmojbjwtmi0kwxnwuqjsogu4kh8dybsh2gdhx6ku96zadkprwdne8wgzpy1mdwoxexy2xfw3cckawfy4nyqsln2ukcjb2fbqrmdpgyrtazbiupbwbdf3qqz44wbn96efrfzgcf/pwhz/wmrciuaqd6ncgpazid3m4gyd7cig5mlmpvxjgla5bjw94i2iwqxxfftw9svyjlaiqgd/mop8y7nmnchob3zqebqq/4oicivumgpziuaa9kkhtu01h3teezv0rl1r0x29gj6mwsmhppiurhsdabtdsrhf62a2jdkelpzrueivg2hvywec6dkela4gdh3y6ck/tna+osiqkjchiraivqewthq2oytg52cpw1/nnomwixonl5uoconyf8ilq/ydvqvdq2v6keq7osiahdy2wq6h1ucugkgm29jnn+qcup8woddnc3rejdkdz6melykyahrcwh0usqhbgeemdahoiovbhefxbrgmhqdmtufyqibadioxqb6nkqpyjaeqiahgow8vtkno5ivcxc40i/e0/vhktvl96va//frvjwbbfosrhjxdgyucrxgit4csaosvjlwulqexlbsjvqcjdedwob+ykogyoha8gpeo+sie7sa0bef5wwhd2x02xbzoyo+vdhojqbz5m1r2ppqrmqwkhqnj3vkyfrcuawynsptvwdjplxtxrhnm84bnxeaytrkg3xphdaab4d/a8p7gshwxw4ubgnq5df4uc4qybwv/jjqtqh76yjvyy120wmtg6sutfuxejpmc3xi8k8ibv4ebh70cgnrrhsn2ogh20ts06lpaxeyhdiaibsd4w+q+dig8inpeiqd63eljer34juqlzyfgugjssl3dxif7myxgijkaweawank/v/29ucs85lkemusglgjm8jbrrxkswoy5lhleuz5ile1wsocklmgpibyhjasqaiwimayk4mnpyrtexfphuwszbb/buna6lylj8afkh+tice5hircwqrn8sz3nlxp5sxcdm4sllygpvkeu8rpeee2bvhe9481/wc5h0hgkcxbkzrvxsbidakiknytkqurpqc43rlj9lfkjzr6li4yg5pxsxalky7gn+6g6yhi9pbzg2kpjtyyhy6rzyaej5jlo+qn4eluxb6kpwmrbc9jfaoee9o1tvsrbwbdbicgybn3gd0mgh3+bcf7wcm55r9ktrlvrqqg/kjkphtfoy1dpa4mqssf/jjeps1lqjihhcee1rcpwnfczyhatlwikj4bahoqa3yjtlbcmytqdcdiemwnvsidj4ihe63ahtpjkvbt5wtgd86osqrsft0sncicmbqb3cmnnl1b4vvolgfg89p9e31ttmz6pckbwikatfps8ukl/nusybchgfloxbpa4wszfdokxal0ejiyeqgqhd7eeie8cghgbxifidchb9aao6h6t0ypk08n1ihhyhtvpnlkiu9qu6j1a/eqxzahhblx4qjsuoj8kzv5mejbj+rwyla+dne2a7x4krs/ctzklpk0nca+ihvvvhinrydw+oupqbxqopkx509mm+2jzjxa+zmax/lgiri1myigdlomsq5svfqxcbce6yax8c4yjqi579odeq/utv+li0gg1cxnocoibdomz54q/glg7xsaq0ie9sgmhsat7hajhmrywfaw8csbc3viatri0a0tlpqw+wcuu34xyxqs9ltffk5nji9d+knnok4zpftfh6sgr64avgsaq5oacxuayx4auigawsqar3dwh8cagaf3pzpm9qr2wybqhurnptvgmnvwqs8aicuakduiwsifvisw7+gafenw23wfrsemc5j4ei6e9ndxdgqe//5e9smber0tiuqsgnxwbpl3i/sqd4mdrpwsjfdldes1fhvmmvika4hwwdmau+/xalpdalxgalscamvkcj4xdnjzbq96cigzb6m+bqlsb1prcfrxzfuihlpsal/lciabifamgl6+akvhcb/ncl69aof7aofxn7ducxwzamqqu9fbh7xyabedzvciihddgmt8azmaejzdcqmrebuoehe6aucaqv8jip/wnp4tyuxcqin4cfiycfeoai4rckdtcdjhglrvamp7akq2amvhbnqzckuvhuouhqpickq9zv/biksialbdagsdiaphamnmaktdgrjbmflfsadky3ysangwigismss/y98nbmalaxyzh7ghanmsb3zpcbemauf7ha8sjzhxeikkyirxewp2fzip9wcrmwwobyczr4ibawc8lwc7hwc0syc7madbkgljsabufqbasgbwkzzaugipvwf6fihvxpaqxaca7gcqzablbqcfqykjzaculgc6zacrzwdrzghghfn78ighqtdmqqkrkyhwb4jekayrcmdssiocnwdyxofiqiuisicagsnemdlyhiigeujom3ebbkc+ixc2brildgc5loalnafq1wda/jdbqgllbwcqfwc+cqo1/gc6hieoswel25laooc49alqpim6vqc6zgcytwb4kwr4lgllzndfzfclqlw8diyxyrwgy4lhdrixiogecjbalwk/4aaaiqh7n1dnqncigjoon/rhr7wbs8yrvecubpuzoncog2pweokx6peh44kjso6au5yi/hr4mzqau9ycunaau/8autuau1sal20azx8gpdazzb2zw1qblbyqkfsagcyfr/oaiyzvrluxqsiiaap2vghzwcdsxhipfhkgy89zdt+yamwqzt0aizrjjw4aqe8gazuie4tbjg2xc7wttsajslogk8msklujtub5krahy9qrrykjoviinmezsbyzm+iayzmbydioo5sjsn0au10aq/ykc1cayh0e2bahqnmpapkgu8gqwsr4vnyqqjef/9jocysjygsgioejyy2csnulsvv4cqdq7aqazuqax4yqpu/0afugakimmsamagzpbpwtws4cohkxedpqmvtnetrxpuiacc3lgpoqd+4yeaavqlkugo5cegv0albnomqbak4tcmtaalpeakb4emxeamdcoi+heexdmhspcfolukdqqcq5dfvdmaerqnv5zljqapmwgiemkx1qleyham18aoeiabbra3geaft8mkegfs24ob2ulm6upbjnffxurymic0rlpycdse3eaojlihuaoljdclopmqlngksgcr8zapq2muv1akyfbaajumtvakrvcxpdulsnainih/g7ajdoplfaoic1ahgxrofyblqpzlsqmtwbiyvnd1/izwnkaxfbkci/9xpqlfcwbqde4sd+xganvqcubkbnytujiuvcspw8bgn1qxkyymkepsip+qg2xeoieylisieikwbibgilnqdmjaj6k6nwk7q6mwpb7qcs5wk28rdssqcrvqkavpok2gqhwhc0yvhvbxah26hvspwvyxevavsq7msqzxckzapy6ldtj7lungd6awbj3qzlhypevac9fqan3wdalzddzqdavabujabrgsfwvif1x1lojwdmfgdn3gdtraievbi7dzd4zaph8il40hqj6xbys1b0kiqp1wclfac70ac4sgfrmgpkbycqtqcubqc5gyoldaa+fqcsqqdhlrpruadteqcrd/0ar6xoskj0h9o4bapl+o6gpzigvvj4csqjaaslhybwhdwavegjyqzgwf8aquaftwdq614a7xga4t8w2ewwmiwwgr8a3v8aamqa31mr+1efxnma3coa6ougzqoa3cia6uakzuqpn9scj48aaugau3eavmmfjxeh3zab1toatpgh5csac/wa3sekckeauwalcumwovewzxympgilcnuavnca0mjgvzq70fsqzxi5sraav6hmvrsgxkdl6rv5ab149ztnrua7irh7gvs78drwhcwavq4aweejliwazm0azogays8jb2mvxqoctnma0i3a2eqavvmaz2004jxmdy04vi/4dbwlam2+aqxbam27an1rvdv6ebwvdcgoahlmaer/aetcaevzaftuauyeaerkaeslcavccz8ngkvwamysuwsodeboomrism8+kltjcdk1gkwualqpzexfcq4xamrrcjy0ub+xwkvazqemqkxyl1itrgzem+sgjg73vga9cijvafudyo5uaoammm2wan0pdbi5eovpaqtejoweafgvwi4fang+o97fqnwlaf31ao5aany2dorfk63kan2jcui0z4pvoeuibrpmwecsaeucadtgaetsdctoahyoaetkaeyzapauslhruizqutxzolqramaxkmwecrrfigtdalqsdefp9qw62qosda0ruoc+jbsatyha7godhmcrkg0rbjzvx3of6wzr+a1amym41qc5wazqvqjhdjuqbtwepgd7bgdz9bk8tabkuqo48qbawadttjs8dqc7rfdermajp8ua3ymesidbjgdipckxwlcnhacvuwykoqbueacnxnbbyt2eewa0rgaxjtbb3wczyscz3qczsay6fwcbaazphlcr8agntrokdxc6uzfqxqf13cc8dgpqfd1jwa1fmohaoyp8cg1prfzs6rp2qmv4m7sh8qgn5ccpnmclbddtvwughcduwwdnoqduvwdeakadfgdaxqbavzciwqipobwojadtcqdop/yadu4a6p7lmwwg2lomzfocoygnfvjxzaei1xuavo4arvgnh+aglzldfhcarsmamopasfgazdsapvolg7gaatsjuymbjboga8unq5xcwfyqqlmaupvypfalb8w71xkwt+wxpdywpy2sufcgic9adz0af8dcasxwraait56qgm0ntr2qihywa1ka1gjwu20wjg/q3caa3lwazcufrskastymdfmn24vghrmasg8a2t/lqbew7eiaedlne1ahbsdavq0khvcazc8bro6zq9yqh4yarkam5omawcrqrsgao6kn9roaousapxkgp3fgvp0ap5orcgksufwr/k0n3rydiq/w2mwjaomb2bvsrs4vcr6zda25slvd2sksubevojrywk0fyclc4lng6th4q4dvmha5nqrjajoz4n3baxudmfsvc53zan2edb3rdi8xapr0sn0l0e1i0ertdrddaabrbr9jwo6qao4+25xgafa3xbadcfmaan3sc7qng1ejdkqdzn4ixrlbwf9rdrhd0emib+vvcishklb1ekkqdftiwo1xb6spaoqjalxdiotyja83enxpvtburelb0o6fao4kurfysoxlajqvujehpaqkihsmdi+wfx++xbhpoonscflw4km17qqf4qyzapcrancselveaf3swjy+ao6ndrux4m6p8ak2ahdulachdubbwgdrpgae9ck+bqsepaahhztsj9rqygta/y1uibc0uwbml0e2nuberabfyf37ztbvbq0xhn9umqbadqlk1ac7fgdl2g4kwoghgmdruwc6vgvkvwc1yidlzwlmgsdjxzj7dwfr8k6emac5kwcplzscgwdstwcxgwcouacavwdo1aucv7ze5nzvoyrs4odmaw4wm42zl+8f/hbjp+f6xadleqdtypdl6gnkmqbm6q7tpq3dre81li1a0cdt7gdsbqczv/mekwdcxo5bxq0hk06krqcn5q7lfve096coiwbh6ib2eqbm9g0uza0fqdbbyzbumga/x/pqpmgccrui+zimtokr5fusyoow6b0ang0alvmkd3vfu1cav1oaygyay0ukbfdg6vabclekuazixvk1mmjc0sha3rpkq8mggqvjetp0r9eiuc1nejxyuanhjkxyvvrvypez2z1dkukvanodua8/jlivpasmxt5k2clsbv2fsz4oxcsw3cuoul5+2btw/eudwib8fppaxcniljou7cl3lbkmodhgtkleafkkqj1+3atxng3mczrspwmvpydt1gwsphdsdhmdhxoirjfs5trpqyheuoeu2zanea1uvxmxhpxokjfm7cz2dnzg1kvaqwrgcszlekdi7alnidas2+vapv/6lz4sjljurgc5hspurlkuuo1ffknfgrslsr0exmhd96jaroeb0+fp5s7zmzzaoureyds3co5klobaqjf+nkvrkjclz9y6wefbnswrrwwaatmzef0hehngnyuucbersiz5p43pnvg3cyemcdczzrr4kkugmgc7oquekjr75xb4jfzmkalln8qtgwzvjhiz1vraescsgysfehk7y4wokqcfncdk1ooqacy255ppzjxpfmmfl6wswdvz4bphrzijhlslbgasyyczixzpzubpfltivhlmuvem5zb55ufngjeyproviwtkytk5vm5lgjuys4qaspjiqhikjkquojjjocgf/keea5a2smrsatz7yzckneiygyitslqlwrjpd5uinqf3ckiiukkaggrclvugfnhka8yyewbf875ppuvvlmn3hegqeeclsbxzgjdohgwymg4ci5cbpxbx2xuilfxv9+aawzcyz5bjzingaichttnawaoa6oigpvmzddkluqiezkmco5zpvzjdgmfwlesuuuk4dr8srwzvh3fljitknkk4kbjx1/4bhan+aqkfpk0iijpszl+uidz4s0quhjiwchg4488qidj0eg2w7lrjtb1bztaene0koasairqgijtbbpihhglwnmkweeedtrhhmoqjjimagyuuednbjhckaaiyz/clfpveohgho2kuedwsygicliatljg3oeyefybqiwtpluwihll9domykikiya9wklpezicw+tykigwphazeirksfmmftkzfwwzoibzvljl24nhgdsmrpllymh5nnfktmgfwfus81iz8njbzijgxg00isq4qhkiyozowxcb8ko5t8oas48xkxj5i/mdi4iiuxyfo5nnadxhwijk+ogawxdqaaycpxggjvduok1v6/oet+ddda54btnurfqm6s2qebpcyqx51hm5plgq14kiawvx4tr5ia86sajamtcuzhwhr0vzjfogaqwpscahvujfwwsuylci47kos4yv4lhkckx/4lawgw1wahhmcq0jmvmohw1aiaaevxcczapgkk4bs1ssymuocd2halzc/rqbj4wqoimwmr1skmdjynnjyagxky4wgyrmcdnlciej7bbe208jx3d6izycieejjtcp9xqxzwk4b/yfoyc4rnfg8m3djz0yqtc6ci3mcgmnwmjhmzqiltu4y4ghcm3qydfcpvrcym4qq42osirfqkedphiruei0wbwssxkfqzhv5onl9l0gqwcqxxqssczfrgivttov5lz1wbwwith0kiwycjpavzeijupoxozwauiblikkxaie4/ibo0k9rxc3a4rnybijribhdz5dnbnymrgzjyrqp+jpa+e8mjzhngmbhbdlnjdb9qg0iqzlo0b3shhmz42ag2eyx3pocc951lp8vndc1ugghd0by5mqkmyy+djg8ahzqsigzitgfiko3gfkvial5q4xbgicneowogivrcc4jigaxvzgheri6erwvo5kqudhgmqr/nwib5kxcmvs+hekmxija2dixi3ke1nzhelypydfx34g+74cahokimwydrols5cjo8q4hfskmkxc+a621lcfb5saigeqltffy8qnpiiokyzo53prafb8m+xxnum+6htajw4cycosi1jacmxckbansbhd5cg9p7raauxttcic3hghflh4law9g1urfb/bqsobvn84ytiieejfgecx3bqg4sm4qhlmempagagossbxex4hcvkb4omnmeteesgz2j6c2daa7acg02ygjmbtsicf/54xznoaztcygjrvkddgq6jkjq5gha1mrpazggksvchzjlj2uxaw4mumyivy0acfaawbpbc8xcbkaunhjk82llkev7y2tm+isefgcmbtmpgf7ybdc9mwqvocoexlqfhahqdhvbw6yltuq5/liekylgck3qjfa1w5z/jwmc4uninu3ycfn8yrzri4yx0meeihenbfkagbef6awa++mezmgca1zbhfq4zaw8yxwprjhiytxjgmgoxic3i4jbb/60uahj2dfj0iji3wge4miij7adkqingxcymblvweeo3turin2sihftwahoy4mqjvjcyogrnuezlahdk4qxzke/pynovfzirjlykigtaqow3zobxdtqjevwglyuogdcrnu0cdf6wp9jbdfsiqnou4aiiweaibnidgrngbzfyusqxdgnc4ogkld7xivoi7bjjcmwlaostkpjacey6gg8asgjvmvyacpbde0lhcn8kextpeezm4neo2sqsgwosts1eiqrebraer2iclbq3jmqkog1r6ejh+gbwshjcgynjbsm0tpgzyqqqjgozirsfiuwuohfsgeiv1oyjvlticltgav832memwrhxz6x4xr5l0qgwzeekyireomqhjgnhqbu18babmlgfijrcg9qqgdugwb5wngwdiguhmhoggb7wyhuvaamliqhfxhgjhn88khzyl5nfxqivm2ifv8ahjus8gqlsgawtnnagb1vbtccwgxx80qpb2ngmrjadaeibm1tkxh+qumvssnenzexohq6kk+qsjspx2eiuc5ick5iyhixmwunemiidfmvltdthhbyd8jka0btdagwkf1hdgxlfzuwkdbbrgemtogaiijzjgleaahtymq0jsace3eagj7r5i5jpyadokelemwgoxaxdgcja0dzmoq1mnoisrkkcmpz/pgbfqcmp4wdwoyjxjcykixwhhcatqkafsitdgw1oadvy0yx4tkab4+wgh8cri8tgzh3gsezfbx04px+rb+xi0rn6ghuvp4g0ocjtm3wbuv6da9tj+hxp47sb1niscdip0qcsz8kezxohszcckeiijpgckskdrsgijeaedokscyce3tgyrugdkegdqcgzlhmitgceljgx66cdtwiasiacttavdfafddggcxcvyocex0aabgcgcjchlkacnkghbuajqeggk9ogecca+ggfqfiwzhgacligyidcpbgnwdkhb9agchgavdoglqg5qqigwnagdygh62sfbqiftogenmcd//05bkecfmmwetmahbvhaaw7qczaimnoplxiqcqglxgabssouy6zjf5ohbtrfro6hvpyh1myp5tyjkuckypjdfdkds1wgmqabecwazkbwccdcgobh0ronuswaynoajuog9vbhuyyhmcrqt7qmefohv5gh1saai/qiiushi5ap5glrg3qhj7ovgyhb22ilknikf4ggmnqgdpqbxf4oxmmrfzzlcfqfijeb1arhtqrm2wxvshcqgawgyyosylobyyabyutbrvjghtwbza4kb4qjcn4uiqogsv4gidigrvogh5oaswpgwrmbl6ahwfyowcaklmidogmbnjgbvnwils4bf+bugw3w8rg4auuwlxeiym8geuk3irnaa7woexf+wloq6ar6ikiogqi4om2iimgogtdyyrymab2kibeelb9owzumifqwytncyccecdtaauugajwcif4uar/4ikdgzklazojuacbwiuq2zvrig948azlzjvwkqu24iiu4aiqoiiq6aztod6xaibssev1yipzijby+aqoubc5el8ziaieyixvsqirqlzt8scmeij8napdagcd9irxoawmpiyyqwv4eauvc65aiizxuavakiusg5p24otqwcmm+hvackjdkbmhwrotrim1ie3s2ig+uaq76ii01lspsawumkqtgqrmoat/tcjg0nogx/acdwkkdojboukgz3ahdyghbagfjiacjcieczgh+fevxqgqy0gocsqhbjcebvgg8qynueiwcvchcsiad1okkigvflkay9cgexcacdgg6zuah0usauagrrifsvcchvikizcdfmccmfah0fqw2lkcjhcaonwch0cdizidcs2trwaft6inwjcsulacedafklen5bogjcyfahigcuijxhifmdcmgikhqgjfislbq/gdpmi8ojbnoliud+sdv0qzbgqwiuiclpnalmmgcsiacnrhrvccinccnyiwb7gi9skgl0cctpwfluwvxbeaqqhkciztbsi5n3gh7ngg/4zcbzlyrm5ab3niim9qufbwxm1wbznkcrjxhgjhhgkwbqb4brvhbf54gw8xa4ssadq4lydydnccvh9ea8ulgjlwbzo4vh/g0p2te8jrkltgjqambin7ufeilhplbwxqgh/0gskhhuiathleblvahjpcg5ghgzzogymc0uejikboawhzaimdakbwqoxghfy4koj5ikabairohaj0lf0iqm4ohwfq02xwfqirepebh/9ora8lv2girnwahmkybqdy0xhcqdiybqqsaoprgamyaakoahaibwoqsgcjkkepmnuih1jqbvcjbtnaktr0stoquogeuyx6p8v8ass7l9iqa/+bninmwdaliyzgmav3bkytyzihuwwsxy3wenwc8qkccxnmmyi+uirositmgqbriim4ofnf+vxg5iqd6bslkaiuqaphyw5m6awtzj9rtu4w8ojsmidcqabvcadzqiby4aydkdlpjibspbzjivryaaru/ccrmyz5olniggvscieoss8apdv1icx3ieyfibzzmad0abwybadxqaczxkta4j9c+ova2kgekimyaicftqiz8acbkioh9yeixyte9ycmgfabgarraaygc1mdqowsgcnnmduawr3xwb3yicfesjy+km3ggzcymlguwa4uqiwphefgem5neflsoiqpkiiiqil/ob3aickfcajaynkjzbgnwdagbcah580vjco1eyjophckapiauixxkzupuyokxwgkcgchevhtufkgpcihlyoqmv0pu1ohpqjgp6garmc1anyquygk05afyjcdkihqjgkars0oapchkickhodcfnsoc4nqym0cmxgf3nks1agnixeu8pgngjgcubuplzhi4zoitry35qrjopidxfcckegc64scoeayurzfoxcdrdidozidh0u3imqfboiscpaabxchpskgr3ae62efp80i6jxbvoikctaguklgc2ch89wgz+jwb5igp6nsb/egpmogd8irvvsw7/xobhyqmpuecdgg/3voafcbtbxi2nbqpwe4a6trgnoxojpakignrsigwam1ah4oa1gqbluocff5qdppsdurafuqha6+yjfkh8ljpjwygykagy/ig1z1qa/sautctwujbf4nitfcbjpchjhkgzwqyugiay3ogzw7m1ptu+atgnkabs2qaki4g+7jqqrt47aazl/2hnigbwmqtirojwkggibgtdd1buxbwqxyjagy03hdyqu5gljrwnko3lmkeh+bbxtpagkg1kgigvcjxdpqqooxaj/ovadejuyajl6whxtofwg84judhnru4lvlccolzdvtgi4aazly1dt5pticxzdjgppmvtcsht/ajv+sweu8uiqvkaipaaroaavoiazuccdltiplmiawujpaifu13qb9ypxl66krw8zwazwmtyd5eitvgd/ojaclefuncmtx4spwul5n9i+qcqqrad9ragdteiz6hzvo8iooxqqkint3c+cqigenqmo04kjj6qer0ntywlxtojo3a6er1wbjzg1emcde8aois4capadawfwsiqnerqm34fvooomepueliaib3h0iwgqvswsuqqmj5li/6lxggayjgizy4coeyl6oiycuqajzyaz3kmgogzcobqcemn4x+g90ciztiadjcab3qn5wcadh2izjqiyqgrbgamnmwctogjpthwr/wgek2epqm/yept4hpi6g52fjnvqht16hi5a6f9aocizgfnw/gesbcm0c0ko2xgvrchyaegaflxgph4eh14ihydgnrtyjrs4fzxmhrmg8obxzxuxozb0e+rbwfmyoondftzayq0azuqseiiagpxggndijt1jpnuaqs+gjba8n5bohjjygqokgqjqck5iebka9o4msb4ieoaaeqgjhokponyuesvaab+ajln6pf1o+rpjxgzcq3rilthcnon0gubanlieejbcc02kdcp3jmxi/upcemgjmaezutdxcxb1yvnapsbqahanvubifqhah5udvy2nkdccemhthkfhv3eed/y3oajlrrjrqhzttvnje1utyhnbehfgghclghj2qquwdt29ybtiolgbqu0aohwbqbnf44saoh2+wrm1yhi4wlyjgxw0obqtwl3bqsyjyvwelvmi9gmkgb9yuhn31hvj5id0abhpxahgybv8yb3d4i9bjelyoaox1g5et0pcrg1sgbvlybfeyhqpwrwqrzdkq0dhgave4bvx4qfjyb3o4awcwhrldetpdngubneudbc7w0vztb1esa1dwljutwse7drvga/6mg8km1vjihljgnhbkhmvwyi4sbqkpwm/gpqfagl3gogk04igmfjcyo4uwtlgo3m7l8qhgbnqwhuzihp+yyimpcajq0n5u5qjj24xub1/itneyko+pwyzzuckkkzxzeico2fsleitter+lggvfx4rpkix3063cvvwj7d8rsqzlsibqwaatiimeudq1aozosaal9wptaarnkxhkpal+vndx3k2uwqshpzrv11u3unndgqrscker6wwhsjzl2inogu52gjzf2pqolyiqgcdt6mh/so1s6qvwzqndkwuukaucig2p2qxkaays0gzcmajpeiqoclnshe9m7d4bmm1eav/k/56sgetxafcpndqaojbrggczeawzjwva9qqce4zcyivofes74axtwrh3w9we+kxosivyiavygivgsad/n+cczq8oemcfuagi/suempbnmrcdd0xsda+dliaoqbda+x5zmsdokwkdtzyzpibeb5ghboc4fuwfbikabuhmpuhds0bozy6sajbkp81tec0fvemeyzhbdyhcyu6oc7jemwkibttaivgsjmqtee7ibepwrzu3bumerds37qk4jolchdmo7ulfc+ngcrgnknu6dfjaruu3doc0vatmnypfqtw6fmzmkshldfasyueemmhlqumphgdmfgp0ahzuwkrircryqj2dnvrxzpndhw6dow3itnfkdg0dpoo+tgn75cquov/rgmwuiayznvuoqokdnq3aqynisxdntoixkfns/ymytvcbq23llmxl9gsjzistecdirk6dq3dg1clwb60wphdnhjxrjqxyq23agol7psceo27f0amrvetxmqnqzjv0ztzbub5nwp5r7lejyheiw45m9824rfaxsslilu5eljircuwc1aovmq2zysxy5z7ur2birkwcbasxk3ihkpgcncsyeevf4ogut0hsflpaabbvx2uclvydcaa1bxvceogehxyglryyxhjirrd8dzfhw2kjnphs2hcebbfuqfpzbn18s8we7lqgtsveengko8yogibk23qtzjcuagonlxissw1k3iwdztbemmmnn+fw44sxeldzjdostebonpa9bp+rcd+ai846pktjenmgfqtsdon8i5cqzj4cvcy//ekmjrnqdmqdvzgtzi2xqfmme+w1uwspmjayvx+9wcljkvhcbaavxsqchr100rghg3+ppsafxdhbxxplgewgg22bueeuvqackliiucigv1xmmquuomybllqmdfbzalequkuplwxtejxhlooaazw+qa1p87bwjjnc6cynnlmtuwxsdn3zdzmybipkn+j4k406uxndjju+ckmnmccdz2y4a2z0zjrwvprmdcl585k60gqddtmy+wqmlc54a84td36sp56d1lkmnszoyuwz39aysx++tgxfkz245wtus2tayhrb0dh/ykdueapwf12i0cuvv+rfflgk0teffefpcqfpdwhxxrxadageel34hbgjmpgyqzgiffboudo+dky5vhjm4jy9gonxqxczoq44yzkjl5hendsnobqhey422swdr5fnjnvdukjxji5i5yrqguvwwjmorhe51i06xon5mjyi3emll/a1uotuevpyijcxcnpkl91oq6030fg0c3nylmfeef1bjs8swjji4rw1/wwwhwdu7oewunyx4vdr1nfgwtvvkfsgp1escfpdtmhf04mwmj0p7jigqlugqdnmvd90xm2yzb87hhepg9nrrec6w04dz14ezsmboanbbegce865wsyb/zveoug7utjon450aiaiktgcaciyjpcagbigkybbzlmnx+rcanmcbaa+arq9ewmyapijlxjvi71vkrjqud14fnk5vjtdjvz5lh/aiayvcaekxkbdw/jahz4goiwwgoiu7gcytaskvxsjg4sapxzmhciomxui9kjmf20gyb7qojf4vne3wifdsgwc3+hkdb3rcqmc6whhn5jhjnlaqitnsoy1ajoubtrtwakrerme4kybwqkceiaavtgskyeli4eckkahafclarfhdadtxy9okquzra50v8dgtmgtwjzd4hb2s8cmspgfllkht79bfkbomy9tamuohuqcg36lfg2h5f8kspjcf2qzxdvxysx5qmmadbhftawiqqgkpmcmj0w7/eiby2cg1vs4t3bijx0b3jv/+vanckxaaqqqwliw0aawmwntarrnn8xrdnv0cwja8szg9hgvcixjhaozhzgm0rnpugmca4drn86bwepcyxx1kyc6uhgmylhjkpja3sz605872ccx84gf6gqhimqaixnaqrzkgaku84zqgahzadycsai0fgfxxkmlh6axfjps4qpdgesdgowjrwjmkzn9mtj9soezrxgzmnhek0ohuviszuxnsljdvlcr0vbvhoaqhklmgt1yukmncvhngtecpncyqwhz+mw88pkjbsahbvr/xndiwiekf0vqhbmozy0qw418csad3idasugklvidsxuq+nnuujfpicakdxpcbqhmqqtkfkmxu/gcfczzc3cc4xn28fm+jygwludbacbaiiog5zngsa9rwvqldgojq18h0vnlxaruj7qjtsqiebuy5cd/dwt1imbfdswirjyiawe8lkzbuadxb0aomgkjhovoqzp8za7rmakyw8hwn1xikyu0rkhkm825woxcbsxjgblxxjlgy9ybshvo/qmhnbzhe0dhncruyy+eatwmz3wdc77ohsyoor1mxoipfbvguk4xewxkzstpeyzuicez2c4rppuiqtkjxggekuxdv/rl/ybisdtwbeisqkre5cx0ntndyyfqwr6mgpkvc2xjhuwgox6x2oovgmgf2nijblardyqbeyvdyec5tbfeafjjuvdyblfjnqailks48erynq7dtndgjrwfokophleizzrjy5enhbgaxm5unkmzbvzib1qr2wiw43wweykmytgxwlshvaqkrfrwi6rtvlytisjfjni7puzuiza3awswb8eiyzfvdbfeufn+uim/ucmx9cqgzyyq1n+kbrpsry0bi/gflgrbcktgwiu+eqyzkkk0o4uioh7hdxgqbadesn48lixjowqrsbzngjw4socyie4ybgicfaqgheyyirjooeyrhp/xh2+6a1zemib+xsmmzfgjgbxabiwmiadz2mmbuxdalibccj7b5fhfwisdsitme2eifoea4vrgthu+4hyqorye8hk6lhplquki2oqjlp6xqstmk4dghtkwj2upcwod6khrwrqxd3tqluq1cayrzk2fkncce42aljm8gy4ritfts3nyyb8pqxd4ax7fcixzzssltfshewysrzpimrkhyznaxwfgfkrahs1wgq2wklvusjglei9mgmv4xvnegosxeo489q7k2gvsb30xgxsmftqvwoew2qrmmhrwfcogjiyycruuxyhfw2bw1mcpbxhrqejmfq4wjh6fef0me5xmrsb/blgdacta2vkru8msbmelbfafyj1brre9tru1ieqtclwn/zhzhnnqxkcggfibeaijrubcenjai284t0nmibk+rip1kiaieicwa5g5kittgambxkhzltwhjemsp3mpw88svuefy+gpkpukkxvqzobfumwbpfjdibshcgkapvxbxo2kgrehpoqbzptvastualpidybmasi4aipejmap3n4nqideqst0qarkwrj1hknsawe0giemay+awzqoganiqb05uzywwxrqqrd4qsyautpry0nsrjwegzcgq2yuqs0415kww5i9tdgcljiiamzqwrzmqreuaztxa7qqi0nsmtcq/wmbmb8hseijtgejjajugjb7gmm8fimx2eo+lyzqjn08bi59veyxpmplnvysdbvabmifhejvkqiixahequgdqbydre2jbeibugdggcpryqineaujeeiroeengmhlnzaw6bad/ehueeecamle8yeihoamleipbcdtgiq4rbhppdcveqmrlfyujgys3gcucba7taa3eamn8mpefieo1aksmgm7uem6ean6cyksfaev3ixi2bdfee8xzu8/7rmzneiufeihpeisvmexlan7wjazfgpa3ql7+mjnocxpogh6nqoiqggefim38eijuokdmeibbseasa/f2r8jkiik5ieyyf9cwhuvjojcf7ymhxacj3gbfsqpfklfh1ybe3hbfvsbx6jfiybbggqbfuzkrapnetqcdelgl2ghvfakfzqc001biydh8xmdkyicmsxchwtnh3abelqbcy1j/4xdobqxdxlbegwdfywkznwdozxduvrg43gtxoxjn0rbffhbelibkbwan/dbzqhhlxwd+6xf0ukfucydtarf6hgdm4dll2imjdicbpcbqgtcl4ffiohkf8quicrcao4fhmrsbpgciuqbbilctckcerusindqrpgiokviw1hiiwikfmzbmj2grixkfeiif/ckkmggluxd9bmdbjsc0ddnfasdaejgmnd/qxdogrrgrhwwwwnqsbugwsgeujlcr5wiazrg04twgxcgwrz8qdftqbfkqjb4wo94z7m0lzqvq5r1azj4xjeqqza0garyuc8e2c/yr6i8k0nqzfotqzc4a7guwzpbezheuzeaqrzuggs+407rch8mz056cnmawiwjkzkpmb1ogrykgik4gwcoch2qwrxqebfcujjfer+asvfmasf4cbj0wfdk4bf4gtm4gyxwwmkwqhvmatgqzm4iw3cmzibwbudygjhww2cicdbswwabgxi0yxquwrtiguiyazu81tegdtkua7r9qyyoqrzoaremqrdazn10c3kexc2ozjdqgwt8/xnbsymwvi596mnrrb0s1j04venyngqzqnivhj9dcioetelddcszsieqpulzomovosifjakaksyh+fsifqim5mgv7cr8bokwnnyg1jasdmeuiahkxrqmlbrnimeuemet4zat/v0zyccyluijme0tfbc7cgeyrjk2/fmrpiiwieadcmorlek3saibbeozaqmrdkeqcmi2zmmasiacucipwgemieub1doumakqik6mwjm4yotaxnusdiy6hibxmsnpea6a5jmdiiyhximwqeo3smmowzk3vim3/kqxoina2vmidighuieuzijgcuairiyuzjr08eeesaijkkrcfgf8dv8cmb0mbpwnh2gi8qxgnalgvyxnemsfeixcmxsdo8sdazgdzdsclfrlzo3dunsvycxqysiafnznqwbrswudnuwdmwzdre5aprldambpgswdcryjrpilfzmdaegimsjjmvbdzs6adfkrbladolwhn+rte/weyuscaobltxidjuadgixhvgvft6wcnlifoxhdqwndj6xbh3jifqdcxdkkzpdbfrdbl7zlohftoggcerdbecgbxdrktjngivodwa5ciurrpmvt0pwwhljcoaidbaydo5xlnyydq0xjoigdlhmgexjxz1arjikfdjhjmfzdnerezj6cyztdyfetpncnmpt/wmg4gxrqgrcsgggwy3z5zzgyzjmiazfuqzvkxenipbz1ayymiywdzdwswzzkgjaygwo0y0ygtnkugy+sgnvmw39u6tjyvswaex8eafwqz99havxsgyxcld06sqrhwidiwh3yetvijubvqgkaxa806bc9iw8fj6/mfpd8qsjuqibwapnox0ooa9kw2qcjgw8yc5mesocaiuadrjvcwzuwjgke6hkajqcnbdywxjpeywt4wkr6atkwwxvfvudasog0xevaaziyazoga0tiidcamatrj7jii+d4drncqkgzl554tufwww2qajldgc34jlcsqr7kwykmbcndtilqwhdn/wexjik7mgj3iimsxbja/gevw2elciieggx1chuf/eefxder2ak5ojmeleo3bo4awqpuyy3whaaab+yzfjiaf8mbnma2wa0ky1nhdfbkaeb8kuuyaempbig4soicnq/guiizjeup+imjawakwwmveim1einoam453eqtkcmzoem1apgwgonuvgwcbqvtcuqrgawjbpesmtedkagwszy9lgirjmmm5keo4em8ckcwae4lagw+dsih2mumveithamxbf5p2auwhiivcwiramoa+jw6ag7/dmr0+amageiwvipnngn8bne5ueit8aap7easmiipsairqpmywmeyvhmudp8bpdezpucbgzijfsibhbbbeuxapqebqa+0qnfzdhy0otnyupzzegaummwy6atfwzrwmxqd+1vlnnydmwrfd5atcutujqiwatnruuha9kznbzecd0gzl+xwihwvgpmcl4ydlbjcohbcb80vj1qcifqciqdkfoyzklcb8zmfhucmqmrbpnnzecjbqnyiquf1eowad5jbiptze5qzqadbecxaex41wh/1diw1wzf1wnsawtsawdsae8jbphxbwt+axmt1dds1xd81xtc1duy1lbddammccvq1p7dcl/ggmkihlcadmvq1mljci3ccler2d7szjxx0grqcifiihytqu2f/xwq+j4xectnedvmrawlh9tyfnled9vgtgwujtwvhnhgknw3t9lzftlwbqq3gnm7b9v7/nndjaa0mn3htaacctz4kd3kjaaiaqd6cahrhnwqggarggwlcdwhkd3yhahd3t3chwd3caz6mt3wbggwtgrokd1yj9q3utg20t3vht3yzn2/ptv0bax4bqxdv928pt3axn4atd3ilgxjp93q3n4lng4i/9wde9wc8oiq/+hvj93xja3svahmxn3zrn4d3eajcq4eht4il+iepuimloauenwuk+hd3d3ip9wqswiwvgbduui3bea7kuarkgarsei//+i/na5crqizh+iop/7cjnmcel7mhm4chnziihwb4g3d4tzh3v/mvq7mwj3iks4ajrhikbzmke7kjapixr/izk/msrzmbzzisv7ibw3ici/l4i/k9lhmcr3mjj/ihhzif77mda3mwnziyfzqzq7maw3mbzzicxzmbawf5xzeklzelv7mi4zmb4zmdzzmnd3qcf3mre3qy23mjv7qnb3qna7qnl7mka8gej7ermwaqjlqka/qsrzqmlzqls7qjq7qgozqwn7qwdzuxk3eo40omc7qtxzeyqzihi3exr7u0n3qmbzusl/q0z7u2bzu3z3mmm7uwg3qmr7e4hzuylzu6m3u3f7uup7qvrzu8w/84hou7sap7tcc7su/4nxo5iqt5r+v6q8e7wop6dzp4pa98hmp4uct7uje8w5e7td88qj+awumdc+sdpjj3glv3pvi5x388yie8yi88ybs4lbs6yhc6tns6viu8xl88vmd7xc85eij4pqcbgaabgorcgabbpasbhfyc0au9bhs90r990q+90l+cbts90z+9beyc1e891r+31ss31me9ci841y84hhy9sjm7rw95yze92z/9ohc82nm3jecypfi1grionj9y29e93d893ue93goai/e93zuyqso94jcb4ev8e5wb4p9bgiz+4qochdw+5co95c895tm91f8+5km91w//pudpvdv/pgfoq+hrpxmjumyr+jfte1l4qw9ynegxgrm8vuwt/iomqe3hm+ybqd8f0t7vvtbn/d8hp+czvkitfyp//u/3vvivp/pvveeydukca99d8tz7yzr4gwdivqd4adxsvwf0a/idpz3qqz/4ad9sad+kv/rzqz20fwfsa/zdvxwe/+r7g1wdaijc/yk/vpobxkmyzr4vhgggot9/agaiynhwiycgdgx463er40uzgrei7ngky0iridf28njjoeh/zgo+8vqilbmljkumlhgtgekd/nd2lcizz7pxq4eeo+dqb48evqjucrpltbqr6+d5thov6014zsqqflht/2epnfa6gioju4djjgpzsivz8iffhzkzqm1sf2pajd0chsuo8ukjtj5aewrukboonwykzxkmedaoectrlpr7u+dcnhizdqyilxw4ysjagqs3rkmske29eknsuvwumenwmrtlefnkhz56snr8syk8c4wqlnyzu6fvuztnlfhm2wlhgyq1rvtmcobmk2kz+wnlxyrfgji5evsxirahto04qw9uii2viofp048cxezky5exe+0m/dllhdqnngs+aueccc5pygin2bgjctpwyyql13gzp7bejprrt5zm6ienixwsyb2jmghlixhu3a8z6udh6zrmzuiom+48g4i7mtlkrp8h9b70hi3dclgmi74e4qtj9rprl5ncwroicfboa09iyzjzdyn41qfkac2p4ilaijaksjxvvifnnhnos4cpjaiyyod10kkhplysnmy6njpmlisbhbpqthhsgccwnegjiy6xmjmjrrlsu4gnsmkkydeldmtlueiqqaskmqw7blcnyfn0jdkagoorjcaabda24isesvrajwyyhpyxiokkyndfknpupi2qmqhqck4u5/inhao/oy2ocdizsfdexenqqkhs4c+3rez8skjzwiemnk66zewwyio6p6oni1pjrdettuzsedt7f6+lbacfpuj2akaqwrvxjdpfg1giiulau6v/hyubmsuttrya6peeegdd3yyv82qpmti5r0e1t4snwbu5hgecayhxwm6gyjwqngiika1ao6ynh+zwxjmzqhuz3uwzznz25xxxak7iivnkkuuwyodhxvb3vfkponillpquiiavqzd/ckmee0962mekwakbhjbgwhlxiweeiasktfgxwwo2dmick0rktq/skqjoggcelvri1nxkeq7kbbuevs6pidp4hjqdcwdocu4wdhwzv6ggmgnltrnwzks58bydg8kjt59nj5pjo5kd55pnnrlflhivfdwnificd+qpd1ronynqesatqlh+b4yxy6aykucmfctu9v4eo5mlj1ep/5uknepi1cmab1j5iiigjpnwdwe22huwsofaxosqgrhp1azhcstdo+yaciysb5xjmoecdbxlsvdfkhrt6tgjp40lxxwlumucbye7nsunagsjohgqi7wovtavaehcfqlgkiwiobcjsnumkgei4snpmadttw8qkyiyje9i1gnfe2svgqhizwts8iqrqceziiwdgmbqhjskoyzdbqlx/ochocigjo7hqgwlg0f4ofyak4bmctpwbolk5a0zhenqwqkkknyxrc196tod9bnhmlqqv9qcjrvawjcmgq4ulch8/nbfehnhikppxhaz8y4tbmglswhhsvwyq0xyyoywjiirgp+appdkxgpqhyoizlpb8sjznk6y8iwnaq/zmhyu8zeefunpxxfrlriqpimvbbgcd+drhktsiamukjkyammxou2rct4qphfh58vvjcnfktpszrquwhtxjeniilhjelrgf8gijkkzl+qewwumrcmwxcbgmhhhcz9gbuveg0cwyhwmyaajj/ycaf8a4auumgpmmydkpk3ypfzymhmsgccjxia2ujaweloyahs+ibe7eqjwrhjaa6wblpudw5qpg8cqjeirmsxurwn4skjg8bumfkv8cgpa5swntdmrkypbm5bqdseo4igmqd1rfadwutjr3mwh6yajmptgndumy4hlowf/o93ji3qizjk2+ccrece4fwsjfkqdzzdeyb6ljgqexkicq8rgjmri0ot9tm96wjejv7gcpab84dyooyw2sckheooeabzbjmtcjn7vqcaxqtu+xhbshgyagheoola2zikhhuebkh75y44dah34i5+zkgcoji4jgtawrjwisbobmxffaytwxjx2kmklsaucc8y4ysvbc0hdfdggqiwwkapgpeuhxiaj0mqbdd3eohyltbowfisneeylcgtnt1qr1m9nrfuwridr2poqsvboywfvmeu5l9rpqhccguyyrjeacsbvtgmaykawvvsajnfgghgubyrdfesur0c2bzzgbwdd/2nf06qjzjqnh4joiw5iximaxphigu2tdi9nzkm9rdmge2thnjolq3jkmjjfacduskizrkgakltbcluyrratkiuc57govqtifs+grqmnr1+v8guebjgc4bpxxulm0mhimpultwhcpns3u5tmlitcy4pcpkn6dkogax6hxw54kzgzdzyysys0bzqdhebghv1liw4ydgupo+bfn1pxdtuzzmdjunhmtitryrgmzqy504fo44p3ka6vbf5gnj4rgdl0wuvjwko4y4umog61qyq6h1phwys5ls2p47gflvkriqpjghxpidedj8zcdknufosaril64iuhjieqkdyu8foozf8qfwiegjjdk4ntxbstzbsuiwt0/nwibwztg+jkbtgyui1rvinz1xjaolrrdm544xhpbgqulpgaa6ejhwnqasjqgy54xanzl80cguoxk8malgjwcmajn/wn+hrrfvbdkisg5a1qlpbyed7tmdakuhum11zb6euqeihhbwvds94chyxkmwoklw0dvjh4qrficvlsmsbedfwceuwtsbghkyt4qx+c3n1e/oepktyywdmxc5sfwrug5eqmboeutngxkotibpxk8w1idceircjen9jxjpohcf3hyiyw1mgmlw5rsy0ojtxcgvepg6mzzgdzso7bjnjc4hiehsd+/deoa2d/lsl4o3awuegmasxrzfpszdra0q3mkaulxnzatddaikup4xq0ihvwisekvkiauawaxsy67nfzmk0wmu58cc8bje9li/hrwiu0lhsoepznkok4xoz5maiga2l2uv7pfliae0begq2qflkuj2wl13jhemj7mibe04jjv0ejsigcgy73umow+bzb2iyzvhxtg1vhcpk48lsulq5vomnylawhn/w+jbibzu59ccc0nkenqw+yf6yofde+wyclusw1gieyjmk0sijqgukbzoewaueywghieqhigmelraezncgrziewjkhuaofoikfcsi/lzgeooo7uxqmo5gquwmwcwkep/2zuegwvetzhbnkqcobac/jpydzbkvodtmru5nsne2yiebbqqaig1+wgcqbaoybmc6batz7tvezvzskbg9bbvbzifijacvqddqpb0v4qtb4hhmhhi9qvhlyh+zirwhtihlzhfuphhcyjfuwbpqlvda+es7rktedn+gqwzmamzpybhcyhgbrbf3yhf+kufwibao/bfjzgfn7hf3obgvrhfehn8jrqbddom5igezjp8z7wv87bfjilfwrv9g7beb5gclyjcqlvtyaaejlphlqgemtknyyaephg+e7o6cljc5jgb3yg+liacqzawscbf6kgcymgcrrictleg5ahgliog//ayqyc4duyqrjfyrp6yrpkw93uqzscywayaq3lcbq4gdaezxy6wrmwxquu0cncxe2cwb0kcyvilxy64rggbivsphhc4xgephuyashzwrtiirzawrnayrfbwfeqzx0kbwfbarzkrdq60j2wabiiydnsgqm7jsbgispyq5cqaegoarpsqaqmgaadygigoav1t9j+4pdwow8gyfhe6bmzirgebwgairg4yaqcaecayqhgevxysnpggru0qru2gruqkhhe0u12yagg7iu+osq/rbuiifqib+rgpxnm4dtarwdecysagqqowasywvvcxu1coxv8sovaqu66yrrudodewrp/xdekpaen8zd9foez0g4cgkeilw0zhaecksswsgetklpg5ei4jdivhk8wwkewrbi0hytpmarw0oexpgedtaevk24x+eaqhkyjbjar/gdouayqcc4rooaye8h2bi5rkmeqach6nnal+id5coeytujzrhidds5zak5kumebuoeb1geeygebgufnvsmuomwrv+zzweebjtiimieqhyedwbnbsiayjjalgkecooinoc8kgqcbwfhtvifovkxz/fajtpa/lyavbezokoeywliwjkhpimezjueyjccwfshxkgeyjbixa0g4fkhuziev4gi2wohintlzxseswu/oyiytsmet//zjrfmaniubdzqg14doj1kbej5s5pymrkwoevckj6ev+vqadxxheyqhfqyqg7qvhmqbheyhhlzkfsqbdbthgezbadrhg5blinhqhkabc8ahlcfbfqyacbiapdnbg5zbgmybgelxg7pkhaypghbag5bhi8zgkzwgcscf6ujbh9/0dagoqmwhelqq/icufwltgm6hg+zqturhermyfojbeh0vhi6hisxyfxrqawcbfnybfi6tgmtbqkxp45sgczybeogar5oveiqta47ueihnshkxvqlk5ncud2yt6io0cg0beogaj6drehjohgqhaisbgfjsg8ibhirbgpqudidcmp+2wvmxwdu6qqiuqakywd8u0n7e8rgioqugaamgoelyodylcyqt1iu66hy6gs/jwrz4d0ekoskk7bjmgr3qqv69yd6nqqpnkgq08tx0jgi6exzobwkw4rfewr80yrvwyrziwwljksebkggpwrkavdljarzcthca8xueio5euxbcgregdodqmhg+aaz+ybbolqzxla/oopzolgtszrrafucogq+cljytgrpwyvvx7gwldfaolsp/orzuyrqairumuj3llh3gzxuyqfuq0b3myr7uarq2sf6pyqvaqaqk4bjza1egjhw4ywv/fugoqkr/lwuizaxocjpdsj/78rr+rgd/wceuhqap7cojrkbxqefgveexlsebnofizwebzoehwyeefaewjpmunefbcmftmryvjlew3hr8lvsdxckdtmfmd6esjpmq5oakrqan6gan2qanbqeyhxb2aiep6mbmosedooeqbo8p6san2man6gbnb4frgpyff3zpueyxti9qj6eqwfm0/gwdwmfrk9qc1kfdv42lwqersialfusweiebukfkpdc/3jbm0ien7hdawurz3bfggsayruhakiccyqbbkgqu4acz3e+yeqg9hueujnmvjiehz2gbjweemvyykehwzuexirqz0m5zameymzywakeg0yer5ubhokbmzveh/4kwduogdvladnlthdcgdmkxdugaeexhexjhegbxdxbxdekghvkgbooxnlmxbonqfhdtxznfml5yh1/pk+xvbzn0bk1ohlzggflbgwyagsiwhbjhaazgg4tpx8osjcrcps3bhfqvhdq4janyubxk2z6n/scquirsckzhg/wxoqu4gy5bgeiwfqa1fnybyn0hfxxagc44fvtsfnkhajm4srekfu7huy03y38bq/qadg6hc6qac9zadtdgyj4sehwxdzbhe0azdgzbhwd4df6a8/5aliowd1g4d4kwespth1kskop0uxqbgdhwoq9ahaxtagzgarxbgw5lbkhnma6e8f84zg7biwu14rppgrzcqqg2or6ccueuxdp4oam+yrnuwr261hhmyr7cytrhvu6wka0d1gzmo+jsam6h6rvisro8obycnmr9yrzmwrh8qrj/orzs4ruab45+orik4rfc0bgeobem4xin8xgaqztzgizndw3woek4aakigrgsdjzxfmczoat5ia7cightl5nr7wvvuq50erm+uzu3ywnnghbpibgobhzqyr6mwr3iwuohubyyiru6ax2i2yqkgamyqxskoacms3ko0husmhzu4vnvors4b0pmgkciyqzeyru0irviaroeghqofko5hyr6euofdp3ef/wsvw/pzlmyorb/iqeksyehlrdan5udhkey+vqpqrawi2ezdplxc2evtggwg7ipjrena1iubfgwltb4b0gla6+kzxyqspoo4qcmgqetmnezszoqagg0muewbgwtedp2zxew6watrkebcmeeqlibymexuk4czvqydkwae+sxwqeculydltqbsmb9pfl7prsmw61k1+ebeabss7twqhk6qtjjas3bgejkvajt4uekgwh8mgg6waavzcezhlyzspqyfjtj/toeiniwy2eb8nswficbmcextohaz+eqkzzcn+gjaxhnb7ag+0chhnak+kan8kclk5crhhbdb0f2u1oraig0oy8rqptm+wat/xaistugpmupd3z3dt5hatybgdksxdmus78tquldtbtempd0g5puhbjh36ihgtdqg6hsxrvhqrpborfuw2dbc8cgfngrfpi8dzffcgyhk0hkbsfsxmub/niaywoshcqyhjzhf6cwuhsyy5d1ok3usm0bfk5bgp7bfybzfd5hzknwsknhfxihs1/alv8actxef4lxejbhebacd4zxdye3pgcbe24wtrubntcbeqjbxxf26oball9wxnvatgmbafiwd6lzipm8hdsmqm/hg9qbwn2hadchko0phg5hhhyaq8zhjvgnhbrghrzhggxa+9shc7lgc7hafrcag2xmjgmtw/8m44ymjajsuzioqrtab6gm5xduvbiy4ros93kl4tar0+uo4alvwa+biwmbwxgy0mitfnmtvklx4nnxmw5ilw/kphjegrux3xi3wcivgapqevdjqdp5obkuyau2yapkydhrymuxirhoqkwhkasyyyxjya1aaauhubb0wtqnlhvqrsjsbbziyqkc1by8rbsmxrvcqqk8awl9wclgyrvkwwvlyvm8chu4af2nqbmmqgtvzicrqacakwacbwcaib2efvnalwk9gxhgiyklwremyz1nwr1igrlcix2nhbgr8hrbgzefgihj3z8x8reqycst1rmpgq5++gzr2bmxgrq0ng7/vgbdz1im7p0fmqetojpvuuamumchytrfzzcxybqiugbnrtl0p9qbgmh6jmlklvobmjqn5kqz1hgt09a0/tykg+c5kulrmeeqy6eb7lmujrek2mazekacpvjadahkjnwqkdyyxmpqhyz/ns+hdkmzvh4escexcbobfdkbwcedpmfyjawku3rus2essgeht6gvkdnsj9fx1ay1mt38ctyqbhtxbr8ttv+wr4alinzttzousjwqiiolcmejeto0zzpojxelaaikfz5r1srcca3cn2dvkcapegwyompzii3bxg0cphgaxqlz16abuhdhwiezvqwyqnddfpnlue4avg7b/8yp29bnmzhx4bhaqrilxif5cgxw+yygaudth925u8mn27ap2rthbjdundz06uctoyeuwrxrb5o1m2xml69zagdhpdxrfcxysab5iou31jjkpxoje1bs2lffrqr/+tws2zdv3gcss8qn8h9mgylt4toikwzgph4dw9slsh86dnrk2yyj1ka1gswr4qkkszaua+reuzszez/lxljy+dkf4cyj856wq1lkcpgrsngmglbsijdv385tbeeontbm4majm8vmsjagsoitnjo9zrdlxowhkcfs05apvlywoqeo2q148az5sycaaobki8w88zhgddvsxgnge+6ui5u23yzjt/9saqwztjjiolmgo7x8isxcagnjvc/grgimgslemssqbcucjtpr+bjilm2ag4xgzghgddhiwnodf2iuvbafjfswgx9tthhzibxi0kcfgzbwrx2zyyjjlizumykxlwfcccb0rbfhhhqmguvudmawxrrskmfha+9twww5xhthbsfxzjffk+jlznkp8icjjtncilandvgqrx8vvabsc2pffaoponmkkie5l4wtrbfq2mcglyvdgw47/p0jadjqqmoooduoe1wp7kjgiwisiiaort6ma49m4fb3tdfdgnbnlbxk9ddfzncyilrthwgmwrnk4o4wq6yycewafqpoosn0mhf/kelwygptl/fr5zmymljuqxg0uudbdgxyybrndnjlaq2kcguhy5zml2mbrizmkydgngdsxmzrlzm4tqookw6xoqr9rjsg6zckiboop+fmpell27asxbrcdngfo1rwwqlw8gzjjgllpayojxv70ughsvihedqjmzavnuquwfhuwirwtvqybbnmos8plk5h3shi3wlebbmmxocr9oszivocy1+wge3jx2g5m0tfguxdfluwkbkli2dyi29l8pibnyb/7mzbhzetgxm7r95lybh9rlgbvhvfuqknkpe9cb2annjhk4cwfa9zqmkiyjc+fkpysofwdma5sudldjrdnfke/xjsffjii15a4sghodjyutnltafooumouqubbiwxbbsltyo8poeu2ozgi+xkzuhwjz2vmozkzb04zvjpu0idyxjlk4s1gkw0dp0lfivi/ouxugg7m8+izdgzsy7rtvt2juuehyymbkn5icuhiw9+wwywbdcmea2hd5zwx2qidqtatyivjcgeiapsh8gcajkb6iyc5sgnzcydhdxwbjxy0qcbmcn6ouoytl4hrkherxucueiqdscddi1ddl6qqy2qgh6niwmmrshc8iixbhhauctfgicaphavb4jdoyyzytngyzjvsiub6fcdttibjm2uw2k5+qy4gicdiwrcfshoo/840lgk8bxmglwamxwjy8e5xkiyxeago9jilgocqlxtumicdhgfkhzisphaa7zqzhm/xyyrrahfvaiuh8uqbkti0k0e3mwvp/qbekbgxrzohjpevkiz7qcinsoxaxdizrvoojoqxzgoqcvfhnnhzdpikq1tykiilrdgthgqdl6wqhw04uyzj+cntkwbcenrginagq5jsoaohnfigaeis1yeowmu2ek4kna0niqjhczchlwmwhalemegn2ace6igb1r4abelmfytwhgmvstimjwsrweeqrwcqc8wsdifxd4ri9vmoqpeqaiucdgiogrqk3zoaxf6ocsnkmzenbddmxb/oybs9i8ueiotgzkzqmrvyhoawcqmklgkuncifq9saduayg50cksn5yjqodybgkr4jdrnmbceuhgmvjfggppobknc4q2mlogakcravwrrhuawgruwvibpzqgopibdhmzuidiskaqedcekurdvrxgjqxbobath2wynkmadhacabspqaq1oiaqv4macqpcgldlhd/btrrbbmkhhdqmxhjlibekkxr/s5qul+gqkdkjdwdaziiqhqtsolkcrukozfjxmxqqabyecdi7bwjqomghftmxhdgywizgny4zvzogn6injhhw92q4e4i9vugubrypqoyyhaaqcra9hfnue2jmp/wlaak3bfby7wpuyb8tkhhhngmnipot4vkejdrwhqiagjh+xv0ho8ayxqjcfhrwhbaharwhcga98agefhjwcdwyqrlbiqhbewgc6lpsly4vjhajvn7je1yqd4wu+fypkzf7abtcaoqhcgkmkc5ozqwaieywykcewuyrrpnayecgkwuqxdmcqafutiiczs+pmviquqn0ohzqqko1gcimcluonn5jhqnk4wxc4oy44ooktpcmoi+yojxekybvzlimzzvzvnwobaw+u4jw0g8jesqymsvvnivqwxzz8astuygikuyhcdrccg0tjywurwecohccew+lgbjygqhcgmaqcgv8cglkoxthyuw5zkmldsri1jthdby7iqlrj0iqx2gcjiayenidwakgjkwguugekklgxzqresedcwk2yycqmzbep42hzadtgsxkh10r4rcmd04jzpmzbjgnmdcnvxcpjjsynm2rkde5mijeo0t6jfaq45cghcaehdn8a4agd6ajwhaufo0/bplzqozvvuzyguoedr2ovnatjg104oh8mz0co4aahfjhg4vj4wacmiwmjgoegm7j0emzgi3o44kidhrvvxzeieyeoegdiilvutayxvge+c6gmzgbhmpshbasr0w0es9mgpititlp4w44zf4snt6czqknhd7boxnac1b7/3odfznibqen+iyvetrc3sdipcl9iugrbqzemoxvmsmolixghtbagcv1tqd9vogizrbaew3ajgzgtqaout6tw+nhgificahbbgoyrnugktnccd4zgfer64zayqrhgm9edvhizxeghk+rfmiiz+7ooxapkxorafnxac73pjuaofrgaq6khw7dzixldrks0isphiuqwcbgvt4/jhfmrnzimqw42d8mc1xjakgwfxw/rzbzfapge1bfmnfakixb7xjqhf71ewembomgek1iriuywohbv8iqrhhffw0gxi0ajtozoj8mfjyedaqgac/dbciw1ea6xabh3eadmah+wapo3/3edh3lw8aigmakvgc8pxvuvqhrwkkckwqehcag2dsshwav1vzeozssrqzc6hjjfaah8mdbosgmlmbxeiapziavsaenmpdhw0retmq9af0bhfuptovcyarycmw7cucakybzyjyfs5x1xdv96znbdkhtj50zdwaclirvf9w3imghmctpdrr1gkvx41qvznqzyyag7wah5waibca8ssal5oaidoiagaakqb4crvgouvnkdnwrhmmob0qreceejpyiysugv4dh8mww/mxoqbtib8wx1uxehwyrgsglklrojxqbbobbr93vawq3zcrpnjkxnxbjssg1wfrmwkg7s8btq0p8muqfm5bbegxfu0szcu4g83derajbu4yaszrapt8in08cfpzmn/me0zyqv67aykzinu/giy0cmzcapgnajhpablhapaqaeoychi1eaoeb4kbccjib5gcdxhdc6ojmj6+ajf6bj9ziigwqmplaji5uighbk95imfcgwddcfnpyzisalveqfdvdiwfaotbg96xaognen2ramkkj9rweo8eaacva0x1qhananq6irycv0uugaeqay5sya6rcfozf8ssht8fahpnnl/nemt8aaj/k0zjhk1kerakbev1io1umocmajy2agtsbvxngpgtcg+oap9zchdkgc+ncha2iodtf/aosierendzjwh5v2ezhwida3ki7icabacrurgxudl8a2cyntbl3abxmglxb0cjvgdbiwdm+gcmwgo0xacgrypu0kdiykrrlrcfyqdf9xbe6giidxoxwban5gfedhgfmxkqowhu1ukhdivebfts+zk1uwq9dzz/ogdslqah5edwc4kv8me0reddradl4wd5aaa3kabmzqksqold5oarxglf1hhwhylqpiadnaaam2hwjojpegj0rgcwxgby1qcytqcbxec8mhairwgvryijzal6xrbvowgvzsbjiqckxqda3kdtcqpkagbi0ams1zdtuwdvmkdsbapk1tcn/qmd7g/wy1bdxn8a3t0gxf5kxaxdqksgyksu4bakbvkexr8w1njqhuta1nrh3qdm7mscrgyzluqbfkmshreulqaguw4adyyay9obtgqama4a9pujx40h9zygcfjyb4mgimnp0haal4caiomgmx8aixsam7kglt2gnmuakhvjcbpeqscdivsw+vui8bdgzemjjcgarjef+persma3dxmbkuearukawrsaxzahbriw7mqbtkkbg/glxu0tr8fd2oakzrnq1chq7ushzumag5kii55g2tgn+zvabbfxa9iho9wl7usw2qiaehegy90ap+ckvnckpfuap+sa9u+yzakod1aifpcf+dioekjieoixacngcwlfzel0cehpkiwlijviulyhqzfubrizaihsilm0airda1coiawlbo1trctbrw3pbk3makupaf7ek69ovft3ka8kmoy0aozqaqxoafxrcbvkgrg9kdg8os3dbf/wuu3fars2k0qpivxhdozhg0i8ersrug67ar1pds/lahancldmsgdzcgy1agpycwobqq+1cv/seh98bg54iox5mkbozgh5ap+sabndca47edsubxy/aicisapqabheaifccso1sjldainvanwqyoa5ant7jetjko6xao0ouavaafwtccffmetmbo1vcbjlemwnatzpal0nd/dhdsbejgbrchrx7je8egmb/ixnffda0kaqoyvdb5hd6xe+c0rdlkrpdqixzpxxhrbtjzcepvqmbwlgxwsemvva7rsbvrqvkaqwegq0uqsidwatj5akk6csfgcwxzq5uhrjjwa1ywu5uacfwicd3lcy3wcokgdcvgiogqbis0dooqoufwbi3qdleqb1pabcetbunqbliwfehavzscdthhmfwldavguxohbdwfo3s2dscqdwuqx0vlgcvrdorwes9ynu2kvp7axjcknffmvlhmdtipfruhsktkbl4qv6qalqeie/jmifclxarkqjvkox3qhhwwjh8lglr6jkfkejjl/44ivpauvwszvjygyqmcmggsaay2qizeka3fua7e8au+8ccsohhvlavksau8nwxxzatneawnwbtww4rstrrtqbbbulrfqavikdjceczs93xj4a38oac7gtukisxtdv9vbcdpqmpna76ukwhqcl7cgfttfhpwyaateavuikm8ol86er8zc12kw5wbwr8a0krjmq8mekslzodtxmbikqu3knhvgqigujycd2ltqsdcxkoaka7odkiy0v87ca+0swuzeawhcaa8oq1robxbxmbiqazc9ts7ouxciazbqazscatqfmujsn3luadb0axgzunbuawskl3gglztnslbuwzcgp8w82c+0cdlgaennizf0wyp6cantfcqv7vfxgyqd4u/4uvgsqeuxuycelujzscxyulg/vd/j0daiiurdqfhjqurfvihnyad4yhomnae7+adrxt1vvggbfag6+anbsaox4bv8zabyrwnhsoowtvljdfoshay7rknbgim7iblo/mntqaipocou5bvsvbk6laasvzfy0xdsvkmvkko5adf0gbvxva92jcngjfte7cd8fu7jbgfcbvxpmdsprrgxoywirsgyuyw8tsphrcjatcnahyvcsjg1yyy0nlofgcpmgscvaqiltfonkctwcermgldzba7r8enr1t2rplg6xcg0+d/dnywvcvacecrcazgc9bqdbqhzd3ibv+qbsutj7pdbvktac3jvlb0dvdstrvcdfbxc3tabtw1c/maxd0qewoydafbmxp5z/rfv3svbe2aoxqbvxhbzperuplrdzcnaf2so9b8cwgcalj5f0fn2ozhcen9dwf2ascwspq3a4kiavkaav6wetx6dnaqzkbdriuxesvvk+dadmkg0lccdd4adavwdbtp1hzhvv7ajywjc2ivbubuzprsaogqel42dtpaijgxs1trdysgmosgddaadum3ddzbe91qqgvtgxpf2prlbc2ssq5rxfilxcocxmfcqv7adzitvxhbxvywd5ew/wv64lhzymakb9skj50r8jwntz1jmbji7blfmamqjgm4zabhknvqjnvzqbmcma7q4brooq7k8btd4kwjea8y8q2eqmjecazucseonansdvzxea+jyrn8n9cjac/cqay0wwu07k7lnd7hka1hkqsqaazh7gutfqvwmn+hayebfqx6wyghk9nktdkoyw/9snkxrewrwg+fvqsgga8s4oyl3udnmm0slnf8+aflybkujoht+gi2objvi3wakdprunenjl0kva4/s7rb9hvcsavckfwmwqo7nypnpiluy0y7oq18r8ujuhlbmazvibbvkanntg3m3cjgwazuaae7cazdmv/lvxae9map/ec/piqxatds/d3fmu2mzgzm4euwaedmiju4phrguamjbp7zyqng97dgpu3adz7hql3hzukerbdol/bytzaeogadilvbaicggsq9wqli1qmgxpv1neaflcbc1lb3udbirvnemw46wfquvecyjqor9humqmslsohdxpy+otueazagp7apzn7ftzauyr7tsnxrpdrtccvu/adx/ac4xijsyozz/nspam6vwdmczint6hja00lxczayvwppqydhlycdohadfiyfmipc8/orwibwznqobiam1nelakalstqbttjlbtu6yofoy7tp2kayvtegbmafuxaesld/f7zszawiv2wwczuacmmabgroqmyq5hdb5cpu7bnfkvlmsbbco4rrbhvfd6lkxjxa0xk/o1pzhgf+aain53e+7qfseamgsn54a4d42o1f89eezhsq8zkux2n3buoau+swkk2bkerzek2/dmeujd8wbixzkbqvwpyqtqigdf8h+g2qaatabfyct/tqd2fwa8tza1bz2xef08azzbys7l4flfa98cspuhl/7hu/vzvqaqxo01gppm5j+g8mlix/svna2rtwlof4qztqbrywfow0hfkybs9ee4msvvpxj0pvqjwptpgvdjakbo+km4tsc9dgwezdhqdxjvu3iqwtnems/wrvgjrozpjy5w9adwev/fxw569irqaabhtsufhkr5espxbm6a9ejx5mxkbkcobid3gan4lecy/epgu7oorjcs/apxwr8qlamk/puqznc+tit2if1hw5vuddiu/db10cooyqccogjcafc+4oywsymxdgwp2db3jct4hevthlnrcbn752w4ktn+7coghjvn27xk6bsypforbheyviefnaoburpm7byhdflhxwuuvzmnpofkjkf1hmtiw2b4lkgjukzzalm67w+njmv35mmrb+6fekspm4/fhtcgkxchxca7cyejrpu+rvrefbulqfdrxhx5bdsynhepep+n007pebs/+9fe1+cxt4xdqp37zb8zuh2zzkjcsoiciucqtazhtttgfhahg2cwkkkubt4od6feddja1c6iehlnqqyaknbjoopa+dg2leiyyyw6oldoopnufaalejlhdqp55leklbhhvuyyeffjrs4tohrznkkqw+yecfftjwjgiyjpmhshliemkwc85jbxl0pplmab7g+0uwdoicwjtstclmmwug0qavkqkqpzttvannrry4cscdbshx4oorhlqiih/s+geffjgegj8njnioiw8f6kgj4lwulqbabgiuiotsaokis4cbcbbinu1nupd6sc4cdpglych8tjhknycp02diio3esqn/jbvzzgybzgbwyirscyybu9wsdmt1igvnwg3yakyyd8jzyxx1zcnhmcp6oqfzbaqawshpkhg0jereoikfftrfscskwkorj3kt9s22lmqq9nemzhiurberdyk2td/yp1sz5ixrh558okeohoustjpzp7o1qeisougqrubyeqwbxaj2bhmg4kgjr1xzbx6vev5hzr26ywaecrdqjq9ffulfhw68asscemdzppsqhcxcisf2gjsefkix9xinlkwbttocjum2eqm2kf8zmmic4jquolrqqksa7mb/fhsxyxn9axoxfrpu9r6jpko4yuqowirjq7rk0qtd/t7fif+b/fgg/3r/8o2idb6xyxu68hl82wby8oswcqzycarrotjhcvtq6a0nhtjabzufsg1ua9lyiultaxyyamcpilwxcss4tantsm2ssvjqlsxy4lu3nlwjhtc40e0phiao7rrthrjivkhqbrsmazdcclfsknwjjwxh4xxxooop8bbq6svniswapxsvqoa/mh7qqiwehgpuij56covh3rfon90oegifdwkqjekoiaef0a8f+oajfbmbb+7hopdipb/aarrtzfc2tffwbrlxgvhwhhxvoqafrqqacsq2sedbjzp6mxt2+hawwvmke75y0heggqtlagmd6xhfz8rbgivaixw8qiit3v/ea3/qryfpmbq/flabcsgjh0diaz+oscgadceiejedao22a4na7im8qikpstup0aghb6uyqxroarucmqejjopd73xxipkkto/zys2gwcivepajeseim49wgbqlicwrqzqvc5vilcltltsdo+h2qhyyyf1whqjdfbo0ciuqhc0iuuafg03zth00mco84yfo9pcghxwnrknqawh0wlliheendalh/+qgxwv1iw39wmlnroqotqxnrwpd1nekibdfcnka8qjhcnabghpoiedguqekgvlisqrjklmxxweo9xwp2yaivtqkykbuqeqb4aps0fygihcjepgbda08nth3mvd/xmhda8frxz0g2giqgm8hsyhcrkmqqaagoh6oimiqpfcptg3zbxrgh+sifbzqwqmuj3hexdyvmglm5cvf+yblqmnnelpwhzfiackfywjwjgue5dxkoatzzqwgsreyrif34hksgucbc1yyahoy4aq/hgjd/kihhh7qv+pieq39a0iurobppauhi2g4ahhauoyyueh/axichh66kcbk4tz8eaeyszjszw6si/cahcx84adlwgm2v5mmrlyy2k8582s03raoseg2fejooxn7zgyjkdsl4corr8phv8bcqxvaygiakyotohdmgfzmj4barz88sc45dpmmp+bigybp1ic8/6e3bpvnp87wbaqoiqk8uegajjpmksihmzlsjh8fyqk5bfytlgdhwh6xwccu1iu1awzctlii3vsmpjijrfjw1zwequyzqoxsry6ejxya4ctjjyqxphmjjmi0ngiqwyuuwy+mflw1pnjjgesggvzulakgo4c86lguuqugjkfgqrtenaqd0bxauuqhpx7wag/s8vovosmoudpds6rou+46bds/vhn4ejexkqnyg8ubojkabbsq+cs8nndtba7abd3iau+rgolmxvc6ntwkezi3a0icoqlpocu9fiocp2lgn7tjwxh2azls/aahu4zodmdgild4wb/0mku5xqaborwbbv898igh5eaqqwpghxri7u/ojvhlwaisqijxpmr0tee4asy2dsmgvmygmngnagiobygsoqluwimnqmajb0qqph2soecsmae+okikjaha1fb1slksipvahbcjsxhcbl/qg4zwa4pp40fjkiqkrbaggadjxxkgoqo0maiux2scphvyzw3m+qwoqech5sbfocrkayh+hu40pymq8gupkslgjg9ym5s0bim19m5vveu8j0dciztarqzd4rszgmlf8qjap0qggz5wiecoiwptvmdczcy6h6qnqhlwhkh6mfb0p9gqh+i40be4oddwiaitznypezrqa2c4gw504nvxrpxsvbh/xxjqsw9+7nmyaeajg7mlmnl0xayftmnvmfutfs36ns+opqlbhu6zurredrrjkm7wc0i4bbsqmiqcvfagtkjydgwoqrk6qopuouceqaanq5nsscezaye80ierpbzlfqtun3vhsbl6wwirikdoq2ic/uoe4h5mnapooacmymdsmlihdafrrejs0an+fm6foeejhpbhllas7ksp8iqnqahj2bgmmsn6uutv39iocsauoxgejaobjzmuwhwfaeuzcjgkubavfcvr98la8un+icb5oypbrhbo6nhcwkg8gl4ampanjzrmq74ur4ipqi8mkcejuv1zx/uh4sgmtwu/iogt/8xqbt8caytyfnndskdc+hxqbbefeyp/dzixff0rhsietmieqti53xenf+ggpfs91xsum0apbyyeryaseaa9k3oe2fmzudcd2gqfzzspueajldka43ob5kchhfs+5muy6xapjlcezsmn3magx+mhd+abjua8obael4imkaizhzgckfobibqyousbjvadunocnggzwvkbmzcr49m21ka2qzkbq/kxegeacgs9rii0tcgdkya9/psxxfi67jrd2zcdtgge3pm3rhsfacgeuembatcpmsi0usiemasalwafnmyerzcjesabesg4uikbihcvr9khtaub/9ibm7ack8g10p+zmhxzucmgah1yistcqh4ukyjkoysmkpjxgsp4atk4gzi4gxplaxj4oskdsgpaddo4qfsrfh5wjhc5quywhekwnegsgtdbmd1qnec7q7+imklwwh9lkvgwhedgg0mahdl4vywwrdiqbvwwhezobe+gwelwdddlhekarlawfqeorjxcxotdrcvzrbw4askyjcdygzawpjcgkckcor+ghym4mojcinvzah60ah04gjolwu6dqdtqgyfqjwfbionbhvjqn4z4ooeksh2immqcak5rbgbekuigb3rlwjo0mjq6dytiheqdidiaxkkixaojhv+mbd8yhtasic97bg/0xkz/ubk2jmddawvxairqobs20lpipa7jw5ejm7sfcr59yihuebzwqiuhc4eukmktwi1/udkm+wed0ailcqu5iax75ieneig8+gexuc3a0wfcmrtjo0ihaih1mtomnlb9ykiucczqcd3ra4xawrfr7ad/27ns6yvzekmnolqt9cpa4jce5d0/qc5p2drl4d3cxdhcm6l1aivcyinhge3r2719a8gmginikimtnlo+9a0yaqbqqaenzbgtscsicqgicaf8wif5hiiy+dmr2ic6a4iyok5+gimoeiixqavdysa74gey8anu8ibduokxook2nm4fgaf+84fyaalpuswxgkwg/4glpuknjoohfmgiuia9ueaeofcenjrnm/cergsfogo4sbi9szeomewjtnegisgdp8a5v4chtbvo3em9acwsubgfmesr2pqisiiesqifdmq9mxgdanw9qhasldi32iydltralvez0ewagnobsrshokbrfohnexaci5ibsuabvmowj4iogqmthhrinpab0kicj3a/mwsjx/cbeugyf/gb4zkr8gsdj5otdskydekf9oqhjhob1naep0ipuiaet5ie2/u9uziecjqtfjmdvcbto5oihlcuphovm4dcfpghevaj3/adrpadl6afs9hqnsa5trusfyoer6gtb/rg03wfq/9bh9ichatja08awdnstxplux8zlafwyqasslf4vy7ohxftcanebzjaih0bzhsaj34ywrdgajskfiw7aslqgrjyv4g7ccxbfyzia1syg/45lzq4g+nhidhkaw/oh34yaya4iizgex8yj1iciob4pqrmbml0g0lwve3qhgqebdyotgg0ljlarzsgbdloirmshr+wodlajx4wlfsgbd2wbm8x1uaihfeqafbgawlvtqxrwj6cbfeasg08cu27lla4yj78qmosrtkdzx7jfznohewwzf9tmdoeahzoilaluvcvihdiursajw3oga3gh/56qcfqou3rgc4rfbcantucntt/yiijacau8qaroai3aim2+ohxvbeggcwmukjhogd7eyn/saeskbqgw9egjitb8wnyranbgtprekszcmbh2iduisu449ikarf/6frckj3rg4wamisthawp9bf7lasjvau1jccpjeln0eaprckqnc45amaae4qyskktrfcuwgczpvv/yimzpupzo1mujqoauieisecycfkreiewaiitbj0fuc2j0tamcfpusqilkip7czmoayiqpdqgob16icxkkwhqasjlcjqelaoeqan4oxt+kiefkaesgarufixb9ddnoitrgqxhkak2hawhoe+yc4g0gkbd8eugaalm0ugc/ewz//ryukhbc+rgcdtpriaes3cf+/xgaagfp/ce2asspwdbqudgjo1atdmdvwbqfwdaiqxa/rwfbu1wagadssaggh2kpycdqjhzh1lzz+ubdxhbbvmb8faa3rubh9ilitgcjzhfewgbdxmchfabl90hlkm/pq3s1jdwwikeutgmngkfv6dpmpadp0idm61flzkniywdglueedw0lnjbwkcduqgfeqaqxkmhdvsx/xgis/nlajmnfzidsrifazwerkaeuwdyrtaeczthrvg9+d3hdciedkbpanbbeaqaqx0fa05tvcgeu0vhdqu9cpwh2nyeb/0/adrvw+lyeqahvogac/+ag6hamxzi3bmkatiggaskgqhygotqrqdggsgoapfzacolkktlaiuiauh7aig8g3jltculpxwhh5xma+pkgx1qmqutvc+zqsbycdvssf+pysw2w98tlfeorddxgbswxj6ug1dasmvrq3nfhymfptzvhumgha1vbw/srm9kbcnyha4tlehwbeusawplg7galm78w451bvc4yi/guklwg3efh/1kq49fqywwtykfoacgbwsagvybago+2avotzxfarwwaik4r3oixrc40iigvirsidnalh3yadn4wanjattlcfbisdaibwjgbwiebhy1h1s4webd3nn+bae81omx0hb/aahzifrim8aryesfmk5ggifqggr7ex1rfp1armi0gagjzd+63daf/mf+rckglymxtdbw1yqonbtbgafy09s4amcszqv/c9rl+d/steoo/d21bgq/ibgyuqqookf7oirmdvubdyepofecsigj6yfs6rssgaebga8pogwvu4iy4ifb6c448yezsg6nytdegb1reau5sj91kbqorywxhr0ctgmzqend3eblqdbjnjspop1fauni2fbh1qn5ol3/atzly6ilmg31tifh4iq0fqxadue4civhgeaf9fgh9gfh5b2uujbqw2nq/yhd/kvl8ngai0wlto4ctgs4/sousor8/9lfangac8ihs1okpcihrkjgfdgbwmehizboiiazf8iasdoafjgp28eyknibjtibgcodfwujs7gfpuk4ocieumg6ahibmsudyrmaoyi9ivzqh7gepdaeh8jjdaqeabuef6ahtkgqfwibnajx2amep9jcr2aix9tihycnujenjagfafuequjjsgdyk9iin2zfuvxfup5nkjzklpoujzadc5te65jiedhrlco03jngsxa9cuxpeiicmogjenncu96rjkhgf/qa+tzrexqgnog7emagylcj8isu4kqdukc8zrxwfgowars/ypqhubcwnnces/gbzhwenaisutcdfb4edv8ehzkug69eilpygwjtb6uhaxxph8/xh7nkz92wjrw/pi0mbf8ubdruhcdpstlshb8tpmzc9sv2dxhobh8rblq0x0kozten13tlzfbgq3ombepahdwrnfnvixkwkz2kjktxbw3ybabyjbwkjq3i0r3l0usvgq7aow3pq0ojs3jfszkslq8lhyp8gihacu2gm8e6azrwbtlnjryh6tngbq3cs9qkztiwq2bsiwayupl7oi0edx9sl48ahtnogrfiyk7whhvwhveg4ebwy9m8z4dd2gx2vjyuhubcbzbwa1+s7beoyvkda3ifyltpyugy02gcbu/ot/w951gwgq5phuz/wq2qsg99slv88apwo5husgfonqhp5dhdefhjpjspmkyzxsutqoeuzbrgvwi4uz/62ydfrc1lkaqfcfd6sfnyi7yovdbc44etood9i9n9acamzkblpznpsxh60vlrirfasgp4fpa4cg80matnnmdvvc8nvfxr3d0b9mainy6zhaq2pamauo6pld7xpna/9oyxpwetolpmzuydbdtwohxl+aawoieurbwm2iop0icasagkb483kj4neiesycokpphlq4ncg+if09cwmynrebobugtc0gbybbeygixakonj+jxhkf4aw2jq6aftfgo0ad0gwgjeky82otzlwwhsl477/4qe+grbnzadrqvqp57fnwzjdqvgpfqeqiz+ttizrnndnvdyee80gdhdd96osjq0+eehr9coqmwaqzpkcyaaaqaovgtgr6iafx7n+lsiyn8ueczm5fohb6wkfc7zncbnlx+ogzoc4awyhecpeii0aejtr0cavgh6oeejrw6kuanqnbgksy6zfmjgyul4ro6gs10p+elnjlsoepymysfryq8qozomhflrd9ijeqhyjijujs2ommggquldl41gnchree7kbx+/oqlgewp0xl+kfvbajvqrivikizk8wxnfygckzppeglryqncjv6gyzto7cdwj0znwz3qkdx2os34sdf8slgnu6d+tohbckmakmzfnlpvrac+jshqxohzal0plsievxwb/qkogjsi5g+zo0q+odznfjyznc8zpkeiwlpgzhaoep8bo6i3scbqwylepubo09td9aytiylkoibqkpkhqu08ouunht4rmmpfqkiulwy9hacamolvp7imkkvzqa4ormzxrmrkaiikiiyiunokqjwtidyirikkjkkrfmmkkooocciinnhkajpa40msonaxnizkgybmkklpbkkkhk4dvvbm9+hngfww00aexxpxzrkgewrndrfboyaeij6s00nffyustttizl55c/idmgz/0oghggai0gizt+2xg1x1zqktrccshrpxufzcuue8ahifyrj3wslxugaaumlddkotnx5nopfzfuv0mnmkj/fhjvvl1pfegp6gmcky/hvhtcjahiukijplczhuqifcy1cun5mjki0zoeslbfjwsgsgeieklk8i9ss5ls942yrwqycfcqaa7

Ranking:


Alexa Traffic
Daily Global Rank Trend
Daily Reach (Percent)









Majestic SEO











Text on page:

member login log in now forgot your password? english english | 中文 | 日本語 | 한국어 | pheenix marketplace @pheenix marketplace follow 11 back to auctions saletime.biz is for sale creation date mon, may 23rd 2016 expiration date tue, may 23rd 2017 age 2 years seller pheenix marketplace auction ends in: 0 days 00 hours 00 min 00 sec current bid: $0 $ no. of bids: 0 place your bid watch similar domain sales year domain name price 2013 salledebain.com $60,000 2013 salumi.com $25,000 2004 salle.com $10,299 2013 limetime.com $8,500 2013 salcura.com $6,450 2009 salud.net $6,256 2010 salonworld.com $5,000 2009 tiretime.com $4,388 happy customers you may also like driveassist.com gefc.com utqz.com jvpz.com vxnk.com vmxj.com vlbz.com xvbv.com whois registrant rights and responsibilities api contact abuse terms of service 沪icp备17022494号 icann registrar id: 888


Here you find all texts from your page as Google (googlebot) and others search engines seen it.

Words density analysis:

Numbers of all words: 132

One word

Two words phrases

Three words phrases

2013 - 3.03% (4)
place - 3.03% (4)
sale - 2.27% (3)
may - 2.27% (3)
bid - 2.27% (3)
marketplace - 2.27% (3)
you - 2.27% (3)
pheenix - 2.27% (3)
domain - 1.52% (2)
2009 - 1.52% (2)
id: - 1.52% (2)
year - 1.52% (2)
23rd - 1.52% (2)
english - 1.52% (2)
your - 1.52% (2)
for - 1.52% (2)
date - 1.52% (2)
log - 1.52% (2)
auction - 1.52% (2)
pheenix marketplace - 2.27% (3)

Here you can find chart of all your popular one, two and three word phrases. Google and others search engines means your page is about words you use frequently.

Copyright © 2015-2016 hupso.pl. All rights reserved. FB | +G | Twitter

Hupso.pl jest serwisem internetowym, w którym jednym kliknieciem możesz szybko i łatwo sprawdź stronę www pod kątem SEO. Oferujemy darmowe pozycjonowanie stron internetowych oraz wycena domen i stron internetowych. Prowadzimy ranking polskich stron internetowych oraz ranking stron alexa.